• Üzlet - Vállalkozás

Debrecenben jelenleg is jól működő pizzéria átvételéhez keresek befektetőt - csendes társat ! Az egyedi fejlesztésekkel a forgalom megháromszorozható ! Sürgős ! Csak komoly érdeklődők jelentkezését várom. A részleteket személyesen megbeszéljük ! 30-738-3342
A hirdetés részletei >>

Feladva: 2013-11-27 20:18:20    [Üzlet - Vállalkozás]

Hogyan lehet egy ingyenes hirdetési oldalból állandó jövedelmed? http://youtu.be/TH2sz7UpGV0
A hirdetés részletei >>

Feladva: 2013-11-22 20:59:29    [Üzlet - Vállalkozás]

Gyakorlott és kezdő vezetőket, üzletkötő munkatársakat keresünk, extra jövedelemmel, a világ legfizetőképesebb iparágában a Környezet Védelem fejlesztésének az elősegítésére.A környezet szennyezések kiváltására, megszüntetésére évente dollár milliárdokat költenek. Végzettséget nem igényel, csak szorgalmas kommunikációs munkát,megkeresni azokat a potenciális leendő ügyfeleket akik szívesen vesznek részt a környezet védelem fejlesztés felgyorsításában, elvárható haszon fejében.Ön is vegye ki a ré
A hirdetés részletei >>

Feladva: 2013-11-20 05:33:43    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Fix üzleti hozam befektetés pénz

Ingyenes megjelenés vállalkozóknak a www.ittvan.info magyar üzleti webkatalógusban és még viszontlink sem kötelező. Adja hozzá magyar nyelvű céges honlapját még ma!
A hirdetés részletei >>

Feladva: 2013-11-19 13:06:30    [Üzlet - Vállalkozás]

Weboldal komplett elkészítéséhez tervek alapján Csak az jelentkezzen, akivel lehet egyezkedni minimum részletekben való fizetésről. ill. más megoldási lehetőségek is szóba jöhetnek. Országos katalógus gyűjtő weboldal Keresés, számlázó program, hírlevél, dm email marketing, partnerprogram, keresőoptimalizálás, megosztások, mobil, facebook, és google barát, Budapestiek jelentkezését várom, küldj ref. oldalakat. szepszavak@indamail.hu skype: szepszavak tel 0630/3029639
A hirdetés részletei >>

Feladva: 2013-11-18 12:30:26    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Profi kreatív web fejlesztőt keresek

ELEKTRO-STAMM KFT. Kínálatunkból Villanyszerelés Kamera szerelés Számítógép javítás Laptop javítás Bojler javítás Tűzhely javítás Szauna javítás Hőtárolókályha javítás Épületek villamosítása Villamoshálózatok felújítása Internet szerelés Rendszergazda szolgáltatás Nonstop Ügyelet : 06/30-951-3828
A hirdetés részletei >>

Feladva: 2013-11-13 19:09:38    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: VillanyszerelésSzámítógép javításLaptop javításRiasztó szerelésKamera szerelésBojler javításVízmelegítő javításTűzhely javításnonstop

Műanyag és fa nyílászárók, minőségi, német profilokkal, ROTO vasalatokkal. Beltéri és kültéri ablakok - ajtók forgalmazása a legjobb áron. Online Árkalkulátor - Online ajánlatkérés - Ingyenes helyszíni felmérés - Leszállítás - Beépítés Ön megálmodja, mi legyártjuk. Méghozzá felár nélkül.
A hirdetés részletei >>

Feladva: 2013-11-11 17:21:46    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: ablakajtóműanyag ablaknyílászáróablakokajtókfa ablakműanyag ablakokfa ablakoknyílászárók

A legjobb hitelkalkulátor
A hirdetés részletei >>

Feladva: 2013-11-11 09:37:53    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: hitelhitelkalkulátor

Harasztosi László parafenomén, ezoterikus spirituális gyógyító, kozmikus energia közvetítö.
Banner hirdetés - hirdetése több százezer ember szeme elé kerülhet most 3000 partner oldalon.Banner hirdetés - hirdetése több százezer ember szeme elé kerülhet most 3000 partner oldalon.
Harasztosi László parafenomén, ezoterikus spirituális gyógyító, kozmikus energia közvetítö
VIP. Turbózza fel cégét, vállalkozását. Hirdetés, reklám 3.000 oldalon.VIP. Turbózza fel cégét, vállalkozását. Hirdetés, reklám 3.000 oldalon.
E-mail hirdetés - hirdetessen még hatékonyabban, hogy hirdetése még több emberhez eljusson!E-mail hirdetés - hirdetessen még hatékonyabban, hogy hirdetése még több emberhez eljusson!
Hirdessen itt >>
Adatvédelmi nyilatkozat

ELEKTRO-STAMM KFT. Nonstop Assistance Műszaki problémáiban éjjel-nappal segítünk VIP Ügyeletünk éjjel-nappal fogadja hívását Részletek a weboldalon..... Mobil : 06/30-951-3828
A hirdetés részletei >>

Feladva: 2013-11-10 19:42:42    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: VillanyszerelésSzámítógép javításLaptop javításRiasztó szerelésKamera szerelésBojler javításVízmelegítő javításTűzhely javításnonstop

A Gép-Partner Kft. egyik fő profilja a munkagépek bérbeadása. Nálunk bérelhetők földmunkagépek, osztályozógépek, törőgépek és rakodógépek egyaránt. Minden gépünk mellé szakképzett kezelőket biztosítunk, illetve széles szervizhálózattal állunk megrendelőink rendelkezésére. Kivitelezési munkákat is szívesen vállalunk bárhol az országban. Épületbontás, vasútépítés, osztályozás, rekultiváció, kőtörés, betontörés, nagy tömegű földmunka nem okoz nekünk akadályt.
A hirdetés részletei >>

Feladva: 2013-11-08 10:34:23    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: munkagép bérbeadásvasútépítésépületbontásosztályozásrekultiváció

Szívesen dolgozna Ön egy olyan programban, mely innovatív, örökölhető és időtálló ? Mindez egyszeri befektetéssel elkezdhető, mely nem kerül többe mint egy álláskereső hirdetés! Önnek nem kell „ állást „ keresnie! Ön kap egy olyan lehetőséget tőlünk, mellyel azonnal megalapozhatja jövőjét. Csupán 3 egyszerű feladat elvégzésével biztosít magának: 1.Egy hosszútávú 5 jegyű jövedelmet vagy még többet, 2.Heti jutalék kifizetéseket, 3.Színtiszta arany, - és ezüstrudak fizikai ... további részletek >>

birtoklását, mellyel még jobban biztosítja likvid tőkéjét és jövőjét.

Feladva: 2013-11-07 17:14:07    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: befektetéstőkearany

Tisztelt Cégvezetők ! Adóssággal küzdő cégét! amely lehet nagyon nagy adóssággal, is terhelt, Átvesszük jogi úton. Nem kell mást tennie, hívjon fel a részletekért és meg szabadítom cégétõl, 24 órán belül .Csak Olyan Cégek Hívjanak akik Gyorsan.Meg Szabadulnának Cégüktől terheiktől Bármikor Hívhat Kérésére másnapi aláírással meg szabadítom Adóssággóktól és Cégétől!Mobil 0620/8001291
A hirdetés részletei >>

Feladva: 2013-11-07 16:20:35    [Üzlet - Vállalkozás]

Adóssággal terhelt cégétől meg válna? jógi úton átvesszük más napi aláírással Hívjon bármikor 0620/8001291
A hirdetés részletei >>

Feladva: 2013-10-30 11:59:03    [Üzlet - Vállalkozás]

Megválna adóssággal problémás Cégétől? Jogi úton átvesszük Cégét azonnali ügyintézéssel már más nap alá Írhatja a Jogi dokumentumokat Bármikor Hívhat Fogadom Hívását este ,Ünnep nap is Mobil 0620/8001291
A hirdetés részletei >>

Feladva: 2013-10-29 13:42:48    [Üzlet - Vállalkozás]

Adóssággal problémás cégétől meg szeretne szabadulni? Jogi úton megegyezés után ,másnapi aláírással cégét átvesszük akár mennyire problémás is.Mindenre van megoldás.Kérem mobilon érdeklődjön! Hívhat este bár mikor .Mobilom:06-20/8001291
A hirdetés részletei >>

Feladva: 2013-10-22 18:48:14    [Üzlet - Vállalkozás]

Szállásadóknak üzleti ajánlat Szálláskereső, szépkártya, Erzsébet utalvány elfogadóhelyek, Egyedi országos partnerprogrammal egybekötött, katalógus weboldal létrehozásához keresek tőkével rendelkező üzleti partnert. Szükséges összeg 1 M. Ft. Kb. 1,5 éves futamidőre. 50%-os hozammal.+ örökös tagság. Letisztult reklámmentes arculat, gyors egyszerű és hatékony keresés és hirdetés. Már most van több mint 600 leendő hirdető, akik várják az indulást. Kapcsolat skype: szepszavak tel 0630/3029639 ... további részletek >>

Feladva: 2013-10-18 16:50:50    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Szállásadóknak üzleti ajánlat

Szeretne céget alapítani Németországban? Nem tudja, hogyan vágjon bele? Oldalunkon részletes útmutatóval szolgálunk, s az érdeklődőknek partnercégünkön keresztül német KFT-jét megalapítjuk.
A hirdetés részletei >>

Feladva: 2013-10-17 14:00:17    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: cégalapítás

Irodánk, a KFTkreátor.hu Európaszerte alapít cégeket. Mindeütt teljeskörű szolgáltatással várjuk klienseinket. Székhelyet biztosítunk minden egyes országban, ahol segítségére leszünk ügyfeleinknek KFT-jük bejegyeztetésében. Könyvelés, székhely, engedélyek beszerzése, bankszámlanyitás, folyamatos adótanácsadás, jogi szolgáltatások a Kftkreátoron keresztül. Törjön be idegen, más európai országokba szolgáltatásaival, termékeivel.
A hirdetés részletei >>

Feladva: 2013-10-17 13:56:58    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Cégalapításkönyvelés

Használtruha Outlet! Minőségi őszi-téli Angol használtruhák kaphatók bálás-zsákos kiszerelésben közvetlenül az importőrtől. Cégünk nagytételben importálja a használtruhát Magyarországra. Így egyedülálló árakat, garantált minőséget, szezonnak és a mai trendnek megfelelő ruhákat tudunk biztosítani vásárlóink számára. Kiszállítás az Ország egész területén díjtalan! Ha felkeltettünk érdeklődését kérjük, hívjon bizalommal, vagy kérjen visszahívást. Link: http://www.angoltrend.hu Tel: 06306123497
A hirdetés részletei >>

Feladva: 2013-10-16 23:51:16    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Angol használtruhahasználtruhaAngol ruhaHolland ruhahasznált ruharuharuhákruházatruhakereskedésmárkás használt ruhagyerek ruhamárkás gyerek ruhahasznált gye

CÉGÁTVÉTEL A LEGOLCSÓBBAN! Adóssággal terhelt cégét az ország bármely területén akár 24 órán belül adósságtól függetlenül átvállaljuk! Hivjon bizalommal a hét bármely napján! 06-30-995-7254 Mindenre van megoldás!
A hirdetés részletei >>

Feladva: 2013-10-14 21:29:25    [Üzlet - Vállalkozás]

Ingyenes tanácsadás! Cég átadás-átvétel. Problémás cégek. Házipénztár hiány, tagi kölcsön, hitel, adótartozás. Mielőtt bármit dönt tájékozódjon. Küldjön egy e-mailt s visszahívjuk. attila.koller@hotmail.com
A hirdetés részletei >>

Feladva: 2013-10-11 10:08:10    [Üzlet - Vállalkozás]

Ne fusson felesleges köröket, inkább nézzen be hozzánk! Beszéljük meg a problémáit, ingyenes tanácsadással várjuk Önt! -adósságrendezés -hitelkiváltás -jelzálog hitelek -szabad felhasználású hitelek -áruhitel -államilag támogatott lakáshitelek -lakástakarékpénztári ügyintézés -befektetés -hitelkártya ügyintézés Hívjon, segítünk! Nem csak szegedieknek!
A hirdetés részletei >>

Feladva: 2013-10-10 13:22:03    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: ingyenes pénzügyi tanácsadáshitelügyintézéshitelkiváltáshitelrendezésbiztosításlakástakarékpénztárállami támogatott hitelek

Ha önnek Számlára van szüksége meg oldom! Hívjon bármikor állok rendelkezésére Mobilom 0620/8001291
A hirdetés részletei >>

Feladva: 2013-10-10 13:06:18    [Üzlet - Vállalkozás]

Tíz éve profitot termelő vállalkozásomhoz befektetőt,csendestársat keresek 2.5 mill. Ft-os befektetési összeggel.Évi 40% garantált kamatot fizetek.Garancia: 6 mill. Ft-os eszköz és állománykészlet átruházásával.CSAK komoly érdeklődők jelentkezését várom E-mailen a bővebb tájékoztatásért.
A hirdetés részletei >>

Feladva: 2013-10-08 13:25:39    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: befektetőcsendestársüzlettárs

Fiatal párt vagy hölgyet keresünk társnak plusz aktiv munkaerőnek, most indult (átvett) vállalkozásunkhoz (12 éve müködő). Nagyon jól jövedelmező legális munkalehetöséget és befektetést biztositunk hosszútávra, nyelvtudás nem szükséges. Lakás auto van . Szükséges tőke 5000 euro - tól, az összegben biztositva van a szállás és az étkezes is. A jelentkezéseket email-ben várjuk pár szavas önéletrajzzal és fotóval . S. Zoltán
A hirdetés részletei >>

Feladva: 2013-10-07 12:35:56    [Üzlet - Vállalkozás]

Szükségem lenne 4MFt-ra. Fedezet egy 10MFt-os ingatlan. 1évre kellene, egy összegben fizetnék 6Milliót.
A hirdetés részletei >>

Feladva: 2013-10-06 20:42:49    [Üzlet - Vállalkozás]

Ajánlunk magán-, kereskedelmi -és személyi hitelek nagyon minimális éves kamatok olyan alacsony, mint 3 %- belül 1 év és 20 év törlesztés időtartama bármely részén a világnak. Adunk hitelt tartományban 2,000.00 € és € 10.000.000 . A hitelek is biztosított a maximális biztonság a legfontosabb. Írjon nekünk ma e-mailben : queencurea@yahoo.com
A hirdetés részletei >>

Feladva: 2013-10-04 08:06:55    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Hitel

MLM újratöltve: közösség, üzlet, szórakozás a sikeres emberek találkozóhelyén. Az életünk mindig is a közösségi kapcsolatokról szólt. Az Internet, a közösségi média előretörésével ez ma még nagyobb hangsúlyt kap. És ha ez online vásárlással, online játékokkal, izgalmas kihívásokkal és pénzkeresettel párosul, és már 200 országban jelen van, az maga az üzleti forradalom! Kérj ingyenes információt MOST! http://vezetoketkeresek.blogspot.hu/
A hirdetés részletei >>

Feladva: 2013-10-03 20:14:04    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: mlmsitetalk

Műanyag és fa nyílászárók, minőségi, német profilokkal, ROTO vasalatokkal. Beltéri és kültéri ablakok - ajtók forgalmazása a legjobb áron. Online Árkalkulátor - Online ajánlatkérés - Ingyenes helyszíni felmérés - Leszállítás - Beépítés. Az Ablakland.hu Online költségkalkulátorral rendelkezik, melynek segítségével az érdeklődő a választott nyílászáró árain túlmenőleg, a beépítési költséget is előre kalkulálhatja, illetve a nyílászárókhoz opcionálisan választható extrák (pl. szín felár) költségeit ... további részletek >>

is előre kiszámíthatja. Az Online kalkuláció ajánlatkérésként egy kattintással elküldhető cégünk részére. Műanyag ablakait méretre gyártjuk felár nélkül.

Feladva: 2013-10-03 11:36:14    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: ablakajtóműanyag ablaknyílászáróablakokajtókfa ablakműanyag ablakokfa ablakoknyílászárók

A Gép-Partner Kft. vezetősége közel 1 évtizede tevékenykedik az épületbontás, bányászat, osztályozás, kőtörés, betontörés és a hulladékhasznosítás, munkagép bérbeadás és kereskedelem területén. Amennyiben a szolgáltatások bármelyikére szüksége van, forduljon hozzánk bizalommal!
A hirdetés részletei >>

Feladva: 2013-10-03 08:19:22    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: betontörésépületbontáskőtörésosztályozáshulladékkezelésmunkagépek

Keres sürgős hitel? Lépjen kapcsolatba velünk. Könnyen alkalmazható . Kínálunk üzleti hitelek . személyi kölcsön, hitel, és sok iskola a 3 %-os kamatláb évente. Részletekért forduljon hozzánk e-mailben : queencurea@yahoo.com kínálunk hiteleket különböző állampolgárok pénzügyi segítségre van szükségük , és a nehezen hitelhez a bankoktól , Jelentkezzen most ! csak komoly ember vegye fel a kapcsolatot velünk, kérjük,
A hirdetés részletei >>

Feladva: 2013-10-02 19:05:31    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Hitel

Eladósodott, problémás cégek részére tanácsadás magas fokon. TB-tartozás, ÁFA, körbetartozás, hitel, cégtulajdon, tagi kölcsön, házipénztár és egyéb problémákra legális megoldások. Néha a kevesebb több! Spóroljon akár százezreket vagy milliókat is !! Vegye fel velünk a kapcsolatot: aszatis@vipmail.hu
A hirdetés részletei >>

Feladva: 2013-09-27 17:04:11    [Üzlet - Vállalkozás]

2002 óta foglalkozunk nemzeti, magyaros ajándéktárgyak és térképek forgalmazásával. Termékskálánkban megtalálható az autós öntapadó, felvarrható, és vasalható matrica széles választékban, Papírzászlók, autós zászlók (visszapillantóra, oldalablakra) , nemzeti zászlók, (egyedi tervezés? zászlókat megrendelésre készítünk. Saját készítésű hűtőmágneseket és egyéb nemzeti ajándéktárgyakat egyedi megrendelésre is csinálunk. Címeres és Nagy-Magyarországos gravírozott termékek.
A hirdetés részletei >>

Feladva: 2013-09-20 13:36:25    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: zászlómatricakokárdasapkakarkötőmagyarnemzetitoll

Számlagondját legálisan, hatályos jogszabályok alapján megoldjuk. Tel: 06 30 265 1853 info: http://szamlagond.5mp.eu
A hirdetés részletei >>

Feladva: 2013-09-14 11:33:19    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: számlagondköltségszámlaadóoptimalizálás

Ma már kétségtelen tény, hogy az online világ folytonosan fejlődő trendjei közé tartozik az online kereskedelem, a közösségi média és a direkt marketing. E három irdatlanul népszerű iparág integrálódott be a világon először egyetlen közösségi oldalba. A közösségi médiaplatformokban rejlő erő ma már vitathatatlan. Győződj meg erről az erőről! Indítsd el velünk a vállalkozásodat, részesedj a cég növekedéséből! Részletek: http://vezetoketkeresek.blogspot.hu
A hirdetés részletei >>

Feladva: 2013-09-13 17:38:28    [Üzlet - Vállalkozás]

Meg akar szabadulni adóssággal küzdő cégétől? Jogi úton átvesszük,adósságaival együtt, de ne várja meg, Hogy meg szüntessék vagy a felszámolást meg kezdjék meg kezdik mert akkor már nem segíthetek. Bár mikor hívhat,biztosan meg egyezünk. Hívhat hétvégén is Mobil:0620 8001291
A hirdetés részletei >>

Feladva: 2013-09-12 12:33:57    [Üzlet - Vállalkozás]

Bútorok nappaliba, hálószobába és étkezőbe! Ruhásszekrények, ágykeretek, komódok, fésülködő asztalok székkel és tükörrel, TV tartó szekrények, vitrines szekrények, éjjeliszekrények, dohányzóasztalok, étkezőasztalok, székek, sarok étkezőgarnitúrák, polcállványok, stb... A készlet egy angol mamut áruházlánc vásárlói által visszatérített termékeit tartalmazza. 146 db termék Fix ár: 3206 GBP + ÁFA + szállítási díj Tételes terméklista kérhető. Közösségi adószámmal áfamentes vásárlás! ... további részletek >>

Rendszeres áruellátás!

Feladva: 2013-09-12 10:02:50    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: angol terméknagykereskedelemárcsökkent termékszépséghibás termék

Jelenleg is üzemelő palacsintázó,teljes felszereléssel ,eladó. Érdeklődni a:06-20-579-1178-as telefonszámon lehet.
A hirdetés részletei >>

Feladva: 2013-09-11 12:36:17    [Üzlet - Vállalkozás]

Jelenleg is üzemelő palacsintázó,teljes felszereléssel ,eladó. Érdeklődni a:06-20-579-1178-as telefonszámon lehet.
A hirdetés részletei >>

Feladva: 2013-09-11 12:25:35    [Üzlet - Vállalkozás]

Itt az új lehetőség, teljesen a ZEEK mintájára, a felület tökéletesen megegyezik!! Ma indul, ha csak egy-két évig működik majd úgy mint a Zeek, akkor az nagyon jó lesz!! Adjunk neki egy esélyt!!! A kompenzációs terv is ugyan az. Free tagként regisztráltam, a folytatást eldöntheted te is később. Feladat napi hirdetés feladása. A 100 bonuszt a regizés másnapján kapod meg. Regisztrálj itt: http://www.payofrewards.com/?krobotek
A hirdetés részletei >>

Feladva: 2013-09-04 15:15:31    [Üzlet - Vállalkozás]

Eleged van a pénztelenségből? A számlákon kívül szeretnél másra is költeni? Most ismerd meg azt az egyedülálló modellt, ami szinte az egyedüli mód (még egyszerű emberek számára is), hogy pénzed, több pénzed legyen. Van heti 10-15 órád? Akkor, JELENTKEZZ MOST A WEBOLDALON! http://jolet.sikeresen.com/urlap
A hirdetés részletei >>

Feladva: 2013-08-27 17:25:04    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: állásmunkaotthoni munkavállalkozás

A Gyöngyszem apróhirdető oldalon, mely linkkatalógus is egyben, az apróhirdetés feladása magánszemélyek és cégek számára egyaránt ingyenes, és rendkívül könnyű. A hirdetés feladásához regisztráció sem szükséges, de ha gyakran szeretne hirdetni, akkor előnyös. Apróhirdetés feladása ingyen, egyszerűen és gyorsan, hogy cége mielőbb sikeres és ismert legyen!
A hirdetés részletei >>

Feladva: 2013-08-26 21:44:30    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: apróhirdetés feladása ingyeningyenes apróhirdetés feladáshirdetésfeladás regisztráció nélkülapróhirdetés feladásingyenes hírdetésfeladásingyen apróonline hirdetésapró

Műanyag és fa nyílászárók, minőségi, német profilokkal, ROTO vasalatokkal. Beltéri és kültéri ablakok - ajtók forgalmazása a legjobb áron. Online Árkalkulátor - Online ajánlatkérés - Ingyenes helyszíni felmérés - Leszállítás - Beépítés. Az Ablakland.hu Online költségkalkulátorral rendelkezik, melynek segítségével az érdeklődő a választott nyílászáró árain túlmenőleg, a beépítési költséget is előre kalkulálhatja, illetve a nyílászárókhoz opcionálisan választható extrák (pl. szín felár) költségeit ... további részletek >>

is előre kiszámíthatja. Az Online kalkuláció ajánlatkérésként egy kattintással elküldhető cégünk részére. Minden ablakot mm pontossággal gyártunk méretre, felár nélkül.

Feladva: 2013-08-26 15:26:04    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: ablakajtóműanyag ablaknyílászáróablakokajtókfa ablakműanyag ablakokfa ablakoknyílászárók

Ha sajat Forex Robotot szeretnel,a sajat otleted alapjan,vagy a meglevohoz szeretnel Modositasokat,Extrakat hozza adni,hivj fel:20-918-1973.
A hirdetés részletei >>

Feladva: 2013-08-25 17:25:38    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Forex RobotProgramozásprogramingfxrobotingyenFOREXTőZSDEbanke bankotthoniinternetesmunkafree bonus forexállásbefektetesjobforex robotTávmunka

Cégmódosítás, változásbejegyzés 18.000,- Ft-tól! http://cegvarazslo.hu/cegmodositas_valtozasbejegyzes.html 06-1-321-3465
A hirdetés részletei >>

Feladva: 2013-08-25 09:36:27    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: cégmódosítás

Valaki magánszemély kölcsönt tudna ajánlani?SOS-ben érdekelne a dolog. Köszönöm!!!
A hirdetés részletei >>

Feladva: 2013-08-21 13:03:58    [Üzlet - Vállalkozás]

Műanyag és fa nyílászárók, minőségi, német profilokkal, ROTO vasalatokkal. Beltéri és kültéri ablakok - ajtók forgalmazása a legjobb áron. Online Árkalkulátor - Online ajánlatkérés - Ingyenes helyszíni felmérés - Leszállítás - Beépítés Ne kössön kompromisszumot! Gyártassa le nyílászáróit méretre, felár nélkül.
A hirdetés részletei >>

Feladva: 2013-08-21 12:17:06    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: ablakajtóműanyag ablaknyílászáróablakokajtókfa ablakműanyag ablakokfa ablakoknyílászárók

Vállaljuk, , kazlak, takaró fóliáinak és takarmány silók, szalmabálák Szennyvíz és trágya tárolok, aknák szigetelését, elkészítését pvc-lemezből. 15 év garanciával
A hirdetés részletei >>

Feladva: 2013-08-21 08:46:51    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Vállaljukkazlaktakaró fóliáinak és takarmány silókszalmabálák Szennyvíz és trágya tárolokaknák szigetelésételkészítését pvc-lemezből. 15 év garanciával

Álláslehetőség! Amennyiben hirdetési újságnál vagy grafikusként, illetve egyéb reklámmal foglalkozó szegmensben tevékenykedik, várjuk értékesítő csapatunkba. Nem kell termékeket tanulni, nem kell árakat fejben tartani, a rendszer teljesen online. Csak főállás mellé javasolt. A feladat nyomdatermékek értékesítése (szórólap, névjegykártya, céges jegyzettömb, stb). Magas jutalék (10-30%). Bővebb infó: http://www.olcsoszinesnyomtatas.hu/allasajanlat Tel: +36-70/359-3559
A hirdetés részletei >>

Feladva: 2013-08-18 21:33:32    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Állásmunkamunkalehetőségmásodállás

Fektessen passzív házba! Rövid futamidő, alacsony kockázat. Írjon és minden részlettel megismertetjük! penzugyek@serenipity.hu Bővebb információ:Tel:+36 70 948 9200
A hirdetés részletei >>

Feladva: 2013-08-18 18:03:18    [Üzlet - Vállalkozás]

Tűzifa? Szén? Ha fára,szénre,szilárd tüzelőre van szüksége,hívja a Tüzelőanyag Kereskedelmi Kft.-t. Vállaljuk a tüzelő kiszállítását és behordását is. Telefon:06-20-9541-228
A hirdetés részletei >>

Feladva: 2013-08-18 12:19:46    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: fatüzifaszéntüzelő telepkiszállitásbehordás

Az egész ország területéről várjuk mind a hirdetőket, mind a böngészőket. A hirdetés feladása egyszerű és képek is csatolhatók hozzá. Számos kategória áll rendelkezésre a hirdetés megfelelő elhelyezésére. Az oldal könnyen áttekinthető és felnőtt tartalomtól, valamint duplikált hirdetésektől mentes. Célunk igényes hirdetés megjelenítés, igényes környezetben!
A hirdetés részletei >>

Feladva: 2013-08-17 17:51:26    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: apróhirdetésingyenes hirdetés feladás

A Diamond Top Consulting weboldalán naprakész információkat talál az aktuális konferenciákról, képzésekről. Fő profilunk a konferenciaszervezés, felnőttképzés és a pályázatfigyelés.
A hirdetés részletei >>

Feladva: 2013-08-14 22:51:22    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: konferenciafelnőttképzéspályázatfigyelés

Cégalapítás nettó 19.900,- Ft! Azonnali cégalapítás felár nélkül cégjog spesialista ügyvédekkel! Kft ., Bt., Zrt alapítás 1 óra alatt. Cégmódosítás, cégátírás, egyéb cégügyek 18.000 Ft-tól, 1 órás ügyintézéssel! www.cegvarazslo.hu 06-20-268-6084 1076 Budapest, Garay tér 15.
A hirdetés részletei >>

Feladva: 2013-08-14 11:03:52    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: cégalapításkft alapítás

Veszteséges kft eladó.
A hirdetés részletei >>

Feladva: 2013-08-10 11:54:57    [Üzlet - Vállalkozás]

Kiemelkedö környezetben, Portugália déli részén közvetlen viz parti több mint 500 nm-es étterem és bár, több utcafronti, viz parti terasszal, sajat 4 db.parkolóval mindennel berendezve és felszerelve,+ árukeszlettel + egy wv golf szgk.-val az emeleti részén akár több lakásra kialakithato helységgel, nagy raktárakkal, irodakkal, öltözövel sürgösen a tényleges értek 35%-ért bank által eladó (egyedi ajánlat). Megtérülesi idő maximum 1 év. További információért kérem keressen email-ben.: ... további részletek >>

portugalinvest@europe.com Ia: 205 000 euro. L. Luiz

Feladva: 2013-08-07 17:57:05    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: penzbefektetesvallalkozaskulfold

Spanyolországban és Portugáliában kizárólagosan nálunk átadásra és eladásra hirdetett ténylegesen jól működő nem szezonális üzleti tevékenységek ( bárok, hotelek, éttermek, golf pályák..stb.) értékesitési joga családi okok miatt sürgősen átadó. Beszerzési forrással amely folyamatos, ügyfélkörrel, kiválóan működő hirdetésekkel, több országban helyi kapcsolatokkal. Megtérülési idő maximum pár hónap, szaktudást és nyelvtudást nem igényel! További információ email-ben. Iá: 125 000 euro L. Luiz
A hirdetés részletei >>

Feladva: 2013-08-07 17:17:22    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: penzbefektetesvallalkozaskulfold

Gyerekcipők és gyerekruhák forgalmazása Web áruházunkban és a Pólus Centerben! Akár ingyenes házhozszállítással is, Magyarország egész területén! Nagycsaládosoknak 10%-os kedvezmény. Mazsola gyerek cipőbolt és gyerekcipő webáruház. Gyerekcipő, gyerekcipő, gyerekcipők, gyerek ruha, gyerek ruhák, gyerek ruházat, cipő, Siesta cipő, DD. Step cipő, Pablosky gyerekcipő, richter, szamos, dd step.
A hirdetés részletei >>

Feladva: 2013-08-03 23:20:10    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Gyerekcipőgyerekruhapólus center gyerekcipőNextalkalmiruhaolcsó gyerekruhaoutlet gyerekruhahasznált gyerekruhagyerekharisnyadd step cipőszamos gyerekcipőgiose

TANULJ MEG GAZDAGON ELNI!Forex kezdoknek is! www.100forexbonus-broker.blogspot.com Most lehetoseged van probara tenni magad,INGYEN ,LIVE SZAMLAN ,SAJAT ONERO BEFIZETES NELKUL!!! NE HAGYD KI A LEHETOSEGET! KERESS NAPI TOBB SZAZ USD-t,otthonodbol,kenyelmesen!
A hirdetés részletei >>

Feladva: 2013-08-03 13:29:35    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: állásonlineotthonimunkainternetes munkatávmunkapénzkeresetingyenajandékfree bonusforextőzsdebefektetésonline bankno deposit bonusaranygold

A hirdetésre, reklámra költött pénzed fele kidobott pénz, - tartja a közismert mondás! Nyerd vissza a pénzed kidobott felét, a JÓSÁGSZALON-ban, a JÁTÉK menüpontban ajánlott módon!
A hirdetés részletei >>

Feladva: 2013-08-01 21:57:44    [Üzlet - Vállalkozás]

FOREX TőZSDE --- nincs hitegetes! ez rogton van! azzonal elkezdhetsz kereskedni! http://100forexbonus-broker.blogspot.com
A hirdetés részletei >>

Feladva: 2013-07-28 13:49:09    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: ingyenFOREXTőZSDEbanke bankotthoniinternetesmunkafree bonus forexállásbefektetesjobforex robot

Elektrotechnika elektronika webáruház Átjátszó kábelek Apple DVI kábelek Video kábelek Audio kábelek Audió-videó adapter Optikai kábelek RF kábelek Hálózati kábel HDMI kábel RCA csatlakozók RCA dugók RCA aljzatok RCA toldók RCA átalakítók Jack csatlakozók Jack dugók Jack aljzatok Jack átalakítók Jack toldók XLR csatlakozók Hangtechnikai csatlakozók Koax csatlakozók Koax dugók Koax aljzatok Koax toldók Koax átalakítók Elosztók Fali aljzatok Antenna technika Antennák Erősítők Antenna kiegészítők ... további részletek >>

F csatlakozók F dugók F aljzatok F átalakítók Splitterek Banán csatlakozók Áram elosztók, csatlakozók Csatlakozó kábel Elosztók Hálózati aljzat Hálózati dugó Áramelosztók Tápcsatlakozók AC DC Csipeszek BNC TNC FME UHF N csatlakozók MMCX SMA Multimédia Számítástechnika Számítógép kellékek kártyaolvasó USB HUB Aljzatok USB szerelhető csatlakozók pendrive flashdrive Telefontechnika Dugók Fali aljzatok Telefon toldók és osztók Készülék zsinórok Autós felszerelések Dekoráció Izzók Dugók Aljzatok Átalakítók Biztosíték tartók Biztosítékok Kapcsolók Tápkábelek Kábel kötözők Sorkapcsok Relék Akku töltők Hálózati adapterek Világítás Halogén lámpák Lámpatestek Ledes lámpák LED LED világítés izzó Matsushima Energia takarékos Halogén Kézi lámpák Izzók Jelzőlámpák Ledek Led csík Led modulok Led-1W/5W Led-3mm Led-5mm Led-8mm Led-10mm Led foglalatok Éjszakai lámpák MR11 ízzók MR16 ízzók GU10 izzók Akkumulátorok Elemek Távszabályzók Mérő műszerek RF modulátorok Ventillátorok Hangjelzők Biztosíték Gyors Biztosíték ház Szigetelő szalagok Kábelek Koax 75 ohm Koax 50 ohm Árnyékolt Hangszóró kábel Telefon UTP-FTP 1 eres Kábel rögzítő Kommunikációs kábel Tápkábel Forrasztás Páka állomás Pákák Páka hegyek Ónszippantók Forrasztó ón IC foglalatok Hálózati transzformátor Kapcsolók Mikro Nyomógomb Karos Toló ZIPPY Dobozok Saruk Diódák Nagyítós lámpa Szerszámok Proskit Csavarhúzók Csipeszek Egyéb szerszámok Fogók Forrasztás Krimpelő fogók Egyéb krimpelő fogók Csavarhúzó készletek Bicikli lámpa Zsugorcsövek Rádiók

Feladva: 2013-07-27 16:55:18    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Átjátszó kábelekAppleDVI kábelekVideo kábelekAudio kábelekAudió-videó adapterOptikai kábelekRF kábelek Hálózati kábelHDMI kábelRCA csatlakozókRCA dugók

Vásároljon otthonról,akár ingyen szállítással! Vásároljon 30 webáruházunkból, válogasson több mint 10.000 termék közül, egy regisztrációval. Böngéssze áruházainkat úgy mintha egy plázában barangolna egy bevásárlókocsival. Jelentkezzen be külön-külön áruházainkba és használja a virtuális kosarát, mint egy bevásárlókocsit. Áruházaink kosarát egyesítettük, hogy Ön kényelmesebben vásárolhasson. Mivel egyesítettük a bevásárlókocsit, Ön egy megrendelést ad le és csak egy szállítási költséget ... további részletek >>

fizet. Vásárlásai után bónuszpontokat írunk jóvá, ezzel következő vásárlásai végösszegét csökkentheti. Loréal, Maybelline, Adidas, Playboy kozmetikumok,Fa, Schwarzkopf, Newchapter,Garnier, Dove, Gilette,Goldissimo,Nivea,Brilloance,Wella,Wilkinson, Syoss, és még sok más.. Nézze meg! www.iglobal.hu

Feladva: 2013-07-27 16:28:18    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: LoréalMaybellineAdidasPlayboy kozmetikumokFaSchwarzkopfNewchapterGarnierDoveGiletteGoldissimoNiveaBrilloanceWellaWilkinsonSyoss

Vásároljon 30 webáruházunkból, válogasson több mint 10.000 termék közül, egy regisztrációval. Böngéssze áruházainkat úgy mintha egy plázában barangolna egy bevásárlókocsival.Áruházaink kosarát egyesítettük, hogy Ön kényelmesebben vásárolhasson. Mivel egyesítettük a bevásárlókocsit, Ön egy egrendelést ad le és csak egy szállítási költséget fizet.Loréal, Maybelline, Adidas, Playboy kozmetikumok,Fa, Schwarzkopf, Newchapter,Garnier, Dove, Gilette,Goldissimo,Nivea,Brilloance,Wella,Wilkinson, Syoss..
A hirdetés részletei >>

Feladva: 2013-07-26 23:20:37    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: LoréalMaybellineAdidasPlayboy kozmetikumokFaSchwarzkopfNewchapterGarnierDoveGiletteGoldissimoNiveaBrilloanceWellaWilkinsonSyoss

Ez ez INGYENES Ajánlat 2013. Július 31-ig, szerda éjfélig érhető el http://mostdijmentes.com/lala1959
A hirdetés részletei >>

Feladva: 2013-07-24 19:41:53    [Üzlet - Vállalkozás]

Hála Isten a kedvességét és a jóság az életem Mit tegyek, ha nem lenne a Mrs. Belinda Alba, akit mindig látni, hogy Isten küldött egy nő, hogy Isten úgy döntött, hogy segítsen az embereknek, akik a pénzügyi válsággal, mint én vagyok, egy szegény özvegy, aki rövid listára a pénzhiány és egy nő, aki két gyermek és oly sok feladatai egy nő, aki elvesztette a férjét, és számlákat fizetni, amely a ház és a bérleti villanyszámlája volt megtévesztette az összeg a 2800 $ USD sohasem hittem, hogy még ... további részletek >>

mindig a törvényes hitelt nyújtók, akik online még mindig azt hiszik, hogy az emberek a pénzügyi bajban van, és készek segíteni, miután megcsalt 2800 $ sohasem hittem, hogy van még törvényes hitel hitelező , amíg rábukkantam egy hozzászólást, hogy volt kifüggesztett egy Ms. Marian ugyanazon fórumon, ő elmagyarázta, hogy ő kapta a kölcsönt Mrs. Belinda Alba, aki a társaság vezérigazgatója, ALBA PÉNZÜGYI HOUSE Inc. az idő, nem volt újabb lehetőség, hogy ne próbáljon szerencsét a második alkalom, hogy ne veszítse az otthoni (szállás), így belegondolok, én arra a következtetésre jutottam, hogy meg kell próbálni újra, így felvettem a kapcsolatot Mrs. Belinda Alba be e-mail részt vettek nekem kevesebb, mint 24 órán keresztül, kértem a hitel összege $ 50,000 USD kölcsönt hagyott jóvá az alacsony kamatláb, és miután találkozott a követelmény kaptam hitelt a saját bankszámlájára, így azt akarom, hogy gyorsan használni a közepes és tanácsot minden kölcsön keresőt ott forduljon Mrs. Belinda Alba mailben albafinancialhouse@gmail.com ő biztosan kapsz hitelt, akkor nem kell ismét hangsúlyozni hála Istennek az ő kegyelme az életemben. Ms. Mary alanzo.

Feladva: 2013-07-24 15:04:54    [Üzlet - Vállalkozás]

Különleges lehetőség még néhány napig! Még néhány napig regisztrálhatsz ingyenesen a Dubli-nál: http://webkonfi.com/video.php?user=lala1959 és rendkívüli lehetőségekre tehetsz szert. Hozz egy jó döntést most!
A hirdetés részletei >>

Feladva: 2013-07-24 06:52:38    [Üzlet - Vállalkozás]

Társaságunk elkötelezett arra, hogy a bérszámfejtéssel kapcsolatban felmerült valamennyi feladatot átvállalja és pontos, precíz megbízható partnerként támogatást nyújtson az ön vállalkozása részére.
A hirdetés részletei >>

Feladva: 2013-07-24 00:16:34    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: bérszámfejtésadatszolgáltatások teljesítésedolgozók adatainak nyilvántartásabérpótlékokegyéb juttatások számfejtése

ELEKTRO-STAMM Nyitva : 0-24 óráig Villanyszerelés*Számítógép javítás*Laptop javítás*Riasztó szerelés *Kamera szerelés*Bojler javítás*Vízmelegítő javítás*Tűzhely javítás *Hőtárolókályha javítás*Szauna javítás. Cégek Intézmények Társasházak Ipari Létesítmények Raktárak Műhelyek Üzletek Irodák Családi Házak Nyaralók Villamosítása-Karbantartása-Felújítása. Keresse akcióinkat weboldalunkon !
A hirdetés részletei >>

Feladva: 2013-07-23 11:55:36    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: VillanyszerelésSzámítógép javításLaptop javításRiasztó szerelésKamera szerelésBojler javításVízmelegítő javításTűzhely javításnonstop

1.500 000 forintra lenne szükségünk ingatlan vásárláshoz!Fedezet lenne a megvásárolt ingatlan.Az ingatlant vállalkozás beindítása céljából szeretnénk minél hamarabb megvenni!Bankhoz nem szeretnénk fordulni!Visszafizetés a megbeszéltek alapján történne!Minden érdekelne!
A hirdetés részletei >>

Feladva: 2013-07-21 17:15:06    [Üzlet - Vállalkozás]

Műanyag és fa nyílászárók, minőségi, német profilokkal, ROTO vasalatokkal. Beltéri és kültéri ablakok - ajtók forgalmazása a legjobb áron. Online Árkalkulátor - Online ajánlatkérés - Ingyenes helyszíni felmérés - Leszállítás - Beépítés Önnek csak az igényeit kell megadnia és mi intézzük a többit.
A hirdetés részletei >>

Feladva: 2013-07-17 19:10:45    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: ablakajtóműanyag ablaknyílászáróablakokajtókfa ablakműanyag ablakokfa ablakoknyílászárók

Nyertes pályázat ( ~77M-ft) önrész igazolás finanszírozására keresek hitelezőt, 5M-ra plusz 2M-ot fizetek amennyiben segítséget kapok.Max. 10 napra kellene!
A hirdetés részletei >>

Feladva: 2013-07-16 16:51:21    [Üzlet - Vállalkozás]

Könyvelési szolgáltatásunk keretében segítséget nyújtunk megbízóinknak a helyi adminisztrációs munka kialakításában valamint megszervezésében.
A hirdetés részletei >>

Feladva: 2013-07-15 01:37:25    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: könyvelés

Meg akar szabadulni adóssággal küzdő cégétől? Jogi úton átvesszük,adósságaival együtt, de ne várja meg míg meg szüntetik,vagy a felszámolást meg kezdik mert akkor már nem segíthetek. Bár mikor hívhat,biztosan meg egyezünk. Mobil:06-20/800-1291
A hirdetés részletei >>

Feladva: 2013-07-14 18:16:33    [Üzlet - Vállalkozás]

Most kell lépnie mert Ha cégét megszüntetik ! attól az adóssá önt terheli előzze meg Hívjon Fel még ma És Jógi Úton Cégét terheivel Átvesszük ön dönt mobilom 0620/8001291
A hirdetés részletei >>

Feladva: 2013-07-14 12:03:25    [Üzlet - Vállalkozás]

Belső ajtó, belső ajtók A beltéri ajtókat (alapanyag MDF, tok pedig fém, fa vagy MDF) minden esetben helyszíni felmérés, vagy megadott méretek alapján méretre gyártjuk legyen az bármilyen szélsőséges méret, vagy kialakítás. A minél jobb helykihasználás érdekében alkalmazható a tolóajtó illetve csuklóajtó. A laminálás során felhevített fólia teljes egészében felveszi a beltéri ajtó alakját. Forrás: http://www.tiszaajto.com/belteri-belso-ajtok.html
A hirdetés részletei >>

Feladva: 2013-07-14 11:05:52    [Üzlet - Vállalkozás]

Minőségi, új, bőr, rostbőr és műbőr divattáskák AKCIÓS ÁRAKON! KOLOKOLO 100% bőrtáskák: 8,990ft.-tól! KAREN rostbőr: 10,990ft.-ért! Műbőr táskák: 2,990ft.-tól! Pénztárcák: 1,990ft.-tól! Látogasson el üzletünkbe!: Bp.XII.ker. UGOCSA u.12., Márvány u. kereszteződése. Képek és árak: www.facebook.com/outletruhabolt
A hirdetés részletei >>

Feladva: 2013-07-13 17:13:53    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: táskabőrtáskadivattáskapénztárcakarenkolokolo

Kérem nézze meg ajánlatomat ! 4 lehetőség honlapomon.+ Egy ingyenes szolgáltatás ! Ismert termékek diszkont áron. Étrend-kiegészítők .Arany-ezüst-kolloidok. Egészségvédő készülékek .kávé-tea,olaj-krém készítmény. Gyapjú termékek. Haj-,kozmetika. Ékszerek,divatos kellékek. Háztartás stb. A lehetőség adott,a döntés az Ön kezében van. Várom a tisztelt érdeklődőket, és termék orientált munkatársak jelentkezését. http://www.andreawebshop.ucoz.hu
A hirdetés részletei >>

Feladva: 2013-07-11 20:46:25    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Andrea webhop

van szüksége anyagi segítséget? keresel refinanszírozni? keresel rövid vagy hosszú lejáratú hitelek lehet indítani egy vállalkozást? gyorsan hitel és megoldani a sürgős pénzügyi problémák most érdeklődés olyan alacsony, mint 2%. További információ és jelentkezés lépjen kapcsolatba velünk még ma e-mailben: online.finance11@gmail.com
A hirdetés részletei >>

Feladva: 2013-07-11 14:31:26    [Üzlet - Vállalkozás]

Befektetőt keresek 700 000 ft-al kb 1,5 éves futamidőre. 50%-os hozammal Szépkártya, Erzsébet utalvány elfogadóhelyek, és szálláskereső Weboldal létrehozásához. Célom egy jól kezelhető tiszta sallangmentes nagy adatbázissal rendelkező oldal létrehozása. Könnyen gyorsan lehet megtalálni a keresett információt. Miben más mint a többi oldal? Erre sajnos most nincs hely. Már most van több mint 500 leendő hirdető, akik várják az indulást. Kapcsolat skype: szepszavak tel 0630/3029639
A hirdetés részletei >>

Feladva: 2013-07-10 19:27:30    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: befektetőt keresek

Egyszerűen és gyorsan választhatja ki álmai tetőjét a Bramac Shop webáruházban. Választékunk felöleli a Bramac márka teljes termékpalettáját, hogy Ön valóban az egész tetőt, az összes tartozékával együtt egy helyen tudja kiválasztani és megvásárolni kedvező árak mellett.
A hirdetés részletei >>

Feladva: 2013-07-10 13:38:49    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: bramac tetőcserépcseréptetőcserép

Bécsben élő tolmács és ügyintéző vagyok. Azoknak a cégeknek és magánszemélyeknek a megkeresését várom, akiknek Bécsben tudok ügyintézői feladatokat ellátni. Cégeknek: ipari endélyek intézése hivatalokba való kísérés dokumentumok fordítása telephely keresése meldezettel bankszámla nyitása finanzamt ügyintézések irodai felszerelések (osztrák telefonszám, net...) közjegyző, céges okiratok intézése buak - munkavállalók papírjai könyvelési anyagok ... további részletek >>

előkészítése napi pénztárjelentés vezetése Több magyar cégnek segítettem már, referenciákat szívesen küldök. Magánszemélyeknek: Bécsi lakcím intézése meldezettel e - card (tb) munkavállalással kapcsolatos ügyintézés önkormányzati lakás intézése AMS Nem munkaközvetítéssel foglalkozom! Érdeklődni: 0043-676-457-1980 számon vagy emailen: budabrigitta@gmail.com címen lehet! Személyes találkozás: Szombat - Hétfő Székesfehérváron Kedd - Péntek Bécsben

Feladva: 2013-07-08 22:37:04    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: BécsCégalapításSzékhelyGmbHBUAKtelephely

Ha szeretsz lottózni és szeretnél komoly kombinációval, több ezer szelvénnyel, de kevés ráfordítással játszani, ezt most megteheted. A ForTrina Lottóközösség, azért jött létre, hogy hétről-hétre nagyobb esélyed legyen, az 5-ös 6-os és Skandináv lottósorsolásokon. Van rá lehetőség, hogy akkor is lehet nyereményed, ha egyetlen számot sem találsz el. Email: fortrina.lintaller@gmail.com Regisztráció kizárólag meghívó linkkel: http://fortrina.com/AJ-1000014
A hirdetés részletei >>

Feladva: 2013-07-05 16:12:07    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: kombinációlottólottó közösségesélynyereményregisztrációmeghívóweblottósorsolás

ELEKTRO-STAMM Cégszerviz - Társasház Szerviz - Lakásszerviz Felelősséggel-Tapasztalattal Vállaljuk XI . és XXII . kerületi Cégek Intézmények Társasházak teljeskörű karbantartását-felújítását . Természetesen a Lakosságot is kiszolgáljuk. Műszaki Hibaelhárítás A-Z-ig az Év bármely napján , a Nap bármely órájában kérhető . Részletek a weboldalon.... Tel/Fax : 228-8306 Nonstop Műszaki Ügyelet : 06/30-951-3828
A hirdetés részletei >>

Feladva: 2013-07-03 08:15:15    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: ELEKTRO-STAMMVillamosságInformatikaSzámítástechnikaAutomatikaLakásszervizJavításKarbantartásFelújításÜzemzavavarelhárítás

Országos házhozszállítás !! mlmdiszkont & Webshop Egyszerű, befektetés nélkül is hasznot hozó vállalkozásod lehet. Napi cikkeket árusító webáruház népszerűsítéséért komoly jutalékban lehet részed. Napi fogyasztási cikkekről van szó, amik gyorsan elfogynak,/ismert termékek és márkák / és mindig szükség van rájuk. Regisztrálj ingyenesen: http://mlmdiszkont.hu/mlmdiszkont/bemutato?ref=vu10a12e
A hirdetés részletei >>

Feladva: 2013-07-03 08:07:22    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: mlmdiszkontinternetes pénzkeresetotthoni munkanetkeresetwebáruházinternetes munkahálózatépítés

Számítógépek,laptopok beszerzése,házhoz szállítása,helyszíni beüzemelése. Számítógép hálózatok,Internet hálózatok kiépítése. Számítógép kezelés,Internet használat betanítása. 24 órás Rendszergazda szolgáltatás. Internet kávézók beindítása-karbantartása,Személyzet betanítása. Üzemképtelen laptopok felvásárlása.
A hirdetés részletei >>

Feladva: 2013-07-01 00:25:38    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: számítógép javítás olcsónolcsó számítógép szervizszámítógép kereskedelemlaptop felvásárlás

Kínálunk magán hitelek, kereskedelmi és személyi hitelek nagyon minimális éves kamatok olyan alacsony, mint 3%-belül 1 év és 25 év törlesztés időtartama időszak bármely részén a világnak. Adunk hitelt tartományon belül a $ 1,000.00 USD $ 1,000,000.00 USD. A hitelek is biztosított a maximális biztonság a legfontosabb. Az érdekelt pályázók fel a kapcsolatot velünk most: (patriotictrustfundinc@gmail.com) Tisztelettel, Sir. Maxwell Felani
A hirdetés részletei >>

Feladva: 2013-06-27 12:49:13    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: fel velünk a kapcsolatot a sürgős hite

Vállalkozásunk a világ legnagyobb és legdinamikusabban fejlődő online üzleti trendjeit egyesíti magában: a közösségi médiát, az internetes kereskedelmet és a hálózati marketinget. Nálunk valódi üzleti forradalom zajlik, amely alapjaiban változtatja meg az emberek MLM-ről kialakult elképzeléseit. Nálunk nehéz NEM-et kapni! Már nemcsak Amerika a korlátlan lehetőségek hazája! Ismerd meg a részleteket itt: http://vezetoketkeresek.blogspot.hu
A hirdetés részletei >>

Feladva: 2013-06-26 08:28:39    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: mlmmlm cégekmlm üzlet

Azonnal, több mint 150.000 magyar emberhez juthat el az Ön cégén ek ajánlata és hamarosan 1.200.000 magyar ember vásárolhat az Ön cégénél! Hogyan lehetséges ez? Szeretnénk ezt Önnek bemutatni! Mindössze 3 perc, mellébeszélések nélkül. http://www.magyarkedvezmenykartya.hu/1066615c
A hirdetés részletei >>

Feladva: 2013-06-24 00:15:21    [Üzlet - Vállalkozás]

Az TBSz előnye világos, és úgy gondolom legtöbbek számára egyértelmű. 22% adót lehet megspórolni vele, azaz az egy negyed hozamot. A TBSz hátránya, hogy egy személy egy évben csak egy TBSZ számlát nyithat, egy szolgáltatónál, és a TBSZ re csak az első 1 évben lehet befizetni, majd 5 évig tartani kell.
A hirdetés részletei >>

Feladva: 2013-06-23 09:00:03    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: TBSZTBSZ számla

Villanyszerelés,riasztó szerelés,kamera szerelés,számítógép javítás. Bojler,tűzhely,hőtárolókályha,szauna szerviz. Mindig TV antenna szerelés,dekóder kiszállítás-beüzemelés. Telefonközpont,telefonhálózat szerelés. Tel / Fax : 228-8306 Nonstop Ügyelet : 06/30-951-3828
A hirdetés részletei >>

Feladva: 2013-06-22 16:06:46    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: villanyszerelésszámítógép javításkamera szereléskamera javításmindig tv átállásELEKTRO-STAMM

Velem olcsóbban jár!! Még nem késő! Kötelező Kockázatértékelés elkészítése a már működő,ill,most induló vállalkozások,egyéb gazdasági egységek részére,valamint teljeskörű Munkavédelmi,Minőségirányítási képviselet!!Publikációim,referenciáim a honlapomon:www.munkaszabo.5mp.eu t:36703207497
A hirdetés részletei >>

Feladva: 2013-06-22 08:06:24    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: kockázatértékelés készítésemunkavédelemi oktatásmunkavédelem

Még nem késő! Kötelező Kockázatértékelés elkészítése a már működő,ill,most induló vállalkozások,egyéb gazdasági egységek részére,valamint teljeskörű Munkavédelmi,Minőségirányítási képviselet!-Számlával! Publikációim,referenciák a honlapomon:www.munkaszabo.5mp.eu t:36703207497
A hirdetés részletei >>

Feladva: 2013-06-21 06:32:06    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: kockázatérétkelésmunkavédelmi oktatás

Akkor jó helyen jársz! Azelőtt én se gondoltam volna, hogy az interneten fogok pénzt keresni. Valahogy nem bíztam a felkínált lehetőségekben. De egy ismerősöm által rájöttem, hogy léteznek igazi internetes munkák. A keresetről nem is beszélve, mivel több lábon is állok. Ha Te is otthonról végezhető pénzkereseti lehetőségeket keresel, és többet szeretnél elérni az életben, akkor ne tétovázz,válaszd ki a honlapról a Neked megfelelőt és jelentkezz az aktuális weboldalon.
A hirdetés részletei >>

Feladva: 2013-06-20 18:12:18    [Üzlet - Vállalkozás]

Kötelező Kockázatértékeléseket készítek!Munkavédelmi oktatások teljeskörű lebonyolítása ! Munkavédelmi Technikus Minőségirányítási belső auditor teljeskörű megbízást vállal , most iduló és már működő vállkozások részére is! Keressen bizalommal.Üdvözlettel:Szabó Zoltán Publikációim,referenciák a honlapomon: www.munkaszabo.5mp.eu t:36703207497
A hirdetés részletei >>

Feladva: 2013-06-20 11:21:02    [Üzlet - Vállalkozás]

2013-06-19-szobafesto-szobafestes http://www.szobafesto-budapest.hu szobafestő szobafestés szobafestő budapesten szobafestés budapesten lakásfelújítás http://www.szobafesto-budapest.hu/cikkek/arak szobafestés árak mázolás
A hirdetés részletei >>

Feladva: 2013-06-19 14:28:19    [Üzlet - Vállalkozás]

Sürgősen magánhitelt keresek, kb. 1.5 millió forintra lenne szükségem!!!
A hirdetés részletei >>

Feladva: 2013-06-16 10:23:02    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: hitel kölcsön

Hogyan lehet a hipermarketek árai alatt, akár beszerzési áron vásárolni? mlmdiszkont.com
A hirdetés részletei >>

Feladva: 2013-06-14 12:26:39    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: akcióvásárlásdiszkontleértékelés

Piacon egyedülálló ingatlanbefektetési lehetőség! Ingatlanalap kezelő cég saját finanszírozási konstrukcióban(fix forint havi törlesztő,fix futamidőn keresztül,már 10% önerőtől,) ingatlanhoz jutási lehetőséget kínál mindenkinek,azoknak is akik nem banki hitelképesek. Saját befektetői háttérrel dolgozunk de a nagy érdeklődés miatt várjuk további befektetni szándékozó személyek és cégek jelentkezését. Amit kínálunk:15-20%-os éves költségmentes megtérülés,1/1ingatlan tulajdonjog mellett.
A hirdetés részletei >>

Feladva: 2013-06-13 13:04:31    [Üzlet - Vállalkozás]

Mellékjövedelem 93 ezer Ft, vagy több. Mennyi pénzre van szükséged? Csak a szorgalmadon múlik, hogy ez az összeg mennyi. Keresünk még 3 fő hálózati marketingben, üzletkötésben, vagy direktértékesítésben jártas csapatépítőt. Nem alkalmazotti munka! Ha meg akarsz szabadulni a napi anyagi gondoktól, jelentkezz Telefonon: 06706280391 Vagy Weboldalunkon: http://jolet.sikeresen.com/urlap
A hirdetés részletei >>

Feladva: 2013-06-10 14:17:26    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: állásmunkaotthoni munkavállalkozásüzlet

95 ezer Ft mellékesen Neked jól jönne kiegészítő jövedelemként? Mit szólnál hozzá? Mennyit lendítene az életeden? Csak azon múlik, hogy dolgozol-e velünk vagy nem. Azt tudd, hogy ez nem alkalmazotti munka. Ha akarod a 95 ezeret, vagy többet, akkor jelentkezz a 06706280391 Weboldalunkon: http://jolet.sikeresen.com/urlap
A hirdetés részletei >>

Feladva: 2013-06-07 14:41:37    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: állásmunka otthoni munka vállalkozásüzlet

Fotó stúdió felszereléssel rendelkező számlaképes fotós olyan agilis, jó kapcsolatokkal rendelkező üzlettársat keres, aki modellügynökséget, reklámügynökséget, illetve statiszta közvetítő ügynökséget indítana, vagy már van neki ilyen vállalkozása.
A hirdetés részletei >>

Feladva: 2013-06-07 13:53:15    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: fotó stúdió üzlettárs reklámügynökség modellügynökség statisztaszervezés

Nullás vagy alvó, veszteség és tehermentes,- tiszta céget, lehet egyszemélyes is, átvennék, megegyezés megvenném. Minden megoldás érdekel.
A hirdetés részletei >>

Feladva: 2013-06-06 20:54:30    [Üzlet - Vállalkozás]

Cégek és magánszemélyek figyelem ! Szeretné tőkéjét, megtakarításait biztonságban tudni, tőke és hozamgaranciát biztosítva havi 4%-os fix hozam mellett? Befektethető összeg 1 m Ft-tól. A részletekért szíveskedjen felhívni. A diszkréciót biztosítom! mobil: +36-20-472-4210
A hirdetés részletei >>

Feladva: 2013-06-03 19:53:13    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: tőkebefektetéspénzkamat

Cégátvétel! Cégátadás! Cégeladás! Cég Adás Vétel! Cégátvétel Tartozással! Adósságátvállalás! Adóssággal küszködő, teherré vált, problémás, cégét, ( köztartozás, beszállítói tartozás, hitel, lizing, stb, stb….) kedvező feltételekkel átvesszük. info: http://cegadasvetel.hupont.hu/ cégátvétel, cégátadás, cégeladás, cég adás vétel, cégátvétel tartozással, adósság átvállalás, problémás cégek átvétele, üzletrész átvétel, üzletrész átruházás, eladósodott cégek átvétele, kft átvétel, bt ... további részletek >>

átvétel, cégeladás, cegeladas, válságrendezés, gazdasági társaság, társaságok, adás-vétel, adás-vétele, adásvétel, adásvétele, közvetítés, közvetítése, cégeladás - cégalapítás, megszüntetés, , Üzlet, céget eladni

Feladva: 2013-06-03 09:01:16    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: cégátvétel cégátadás cégeladás cég adás vétel cégátvétel tartozással adósság átvállalás eladósodott cégek átvétele kft átvétel bt átvétel cégeladás cegeladas válságrendezés gazdasá

Az EmGoldex befektetési arannyal foglalkozó cég munkát ajánl. Növelné a forgalmát,ezért érdekeltté tesz másokat az információ terjesztésében. A programban való indulás, egy 540€ előleggel megnyitott 7000€ értékű aranyszámla. Az előleg és a végösszeg különbözete a munkatársak jutaléka! Feltétel 2 új befektető ajánlása a cég felé. Mindenről számlát ad a cég. A munka otthonról, neten is végezhető. Névre szóló webirodában követhető a haladás, minden info magyar nyelvű. Komoly korrekt
A hirdetés részletei >>

Feladva: 2013-06-01 16:05:34    [Üzlet - Vállalkozás]

Meg akar szabadulni adóssággal küzdő cégétől? Jogi úton átvesszük,adósságaival együtt, de ne várja meg, Hogy meg szüntessék vagy a felszámolást meg kezdjék meg kezdik mert akkor már nem segíthetek. Bár mikor hívhat,biztosan meg egyezünk. Hívhat hétvégén is Mobil:06-20/800-1291
A hirdetés részletei >>

Feladva: 2013-05-30 13:24:40    [Üzlet - Vállalkozás]

Vegye igénybe székhelyszolgáltatásunkat, hogy a mini GmbH, AG, Ug tehát egy német cégalapítás költségeit megspórolja. Német vállalkozás létrehozását ingyen vállaljuk, ha a székhelyszolgáltatást Mi biztosíthatjuk. Ebbe a szolgáltatásba tartozik többek között a székhelybejelentés, különböző postai ügyintézések és a telefonkezelés is. Kérje ajánlatunkat, ha német cég működésével kapcsolatos tanácsokra, további információkra van szüksége!
A hirdetés részletei >>

Feladva: 2013-05-28 08:56:04    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: németországi cégalapításnémet cégalapításnémet cégnémet vállalkozásUg alapításMini GmbH alapításGmbH alapításGbR alapítás

AUSZTRIÁBÓL autót.Bármilyen tipusú,életkorú,állapotú járművet beszerzek.Hívjon és közölje elképzeléseit.Magyarországon élek.Tájékoztató és képek a honlapon. OLCSÓ háztartási termékek. Vásároljon mindent egy helyen.Diszkont áron,kényelmesen otthonról.Honlapomon 6500,minden háztartásban használatos termék közűl választhat. Ha akar,dolgozhat is.Nincs bifizetés,kötelező vásárlás.Honlap:www.sajatwebshop.hu/gyozo Hirdessen ingyen itt is.Klikk ide: www.gyozohirdeto.multiapro.com
A hirdetés részletei >>

Feladva: 2013-05-25 17:48:16    [Üzlet - Vállalkozás]

Meg akar szabadulni adóssággal küzdő cégétől? Jogi úton átvesszük,adósságaival együtt, de ne várja meg, Hogy meg szüntessék vagy a felszámolást meg kezdjék meg kezdik mert akkor már nem segíthetek. Bár mikor hívhat,biztosan meg egyezünk. Hívhat hétvégén is Mobil:06-20/800-1291
A hirdetés részletei >>

Feladva: 2013-05-25 09:45:03    [Üzlet - Vállalkozás]

Egyszerű otthon - interneten végezhető munka, korrekt fizetésért. Napi néhány perces elfoglaltság. Minimum 7 online hirdetési oldal meghatározott idejű nyitva tartása. Egyszeri apró beruházással részesedsz a napi nyereségből. Kiveheted vagy kamatoztathatod. ( napi kb. 2% ) Rövid idő alatt a havi pár száz dollár megkereshető. Kérdéseidre szívesen válaszolok a tothvivi68 Skype címen is. www.penzesmunka.hu/addwallet.html
A hirdetés részletei >>

Feladva: 2013-05-21 01:44:17    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: online jövedeleminternetes munka

Adóssággal terhelt cégét Vesszünk át adóssággal együtt,olyan cégek hívjanak ,akik Sürgősen meg szeretnének szabadulni cégüktől,de csak adóssággal együtt vesszük át cégét. Bármikor hívhat Mobil 0620/8001291
A hirdetés részletei >>

Feladva: 2013-05-20 07:38:04    [Üzlet - Vállalkozás]

Valós otthoni munka !! Otthonról is végezhető munkára az ország bármely településéről partnereket keresünk. Kötetlen időbeosztással dolgozhat, folyamatos, hosszútávú jövedelemért. A munka végezhető kiegészítő tevékenységként, kismamaként, nyugdíjasként vagy diákmunkaként egyaránt. Részletek a weboldalon található videókban: http://mlmdiszkont.hu/mlmdiszkont/bemutato?ref=vu10a12e
A hirdetés részletei >>

Feladva: 2013-05-19 11:17:27    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: mlmdiszkontinternetes pénzkeresetotthoni munkanetkeresetwebáruházinternetes munkahálózatépítés

Tartozással terhelt cégét a legjobb, LEGKEDVEZŐBB FELTÉTELEK MELLETT, A JELENLEGI JOGSZABÁLYOK PONTOS ISMERETÉVEL, GYORS HATÁRIDŐVEL átveszem. A legbiztosabb megoldást kínálom, amely nem okoz Önnek problémát. Ne higgyen a mesékben mert nem jár jól! Hívjon most!! 06202878452
A hirdetés részletei >>

Feladva: 2013-05-18 07:47:26    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: cégátadproblématartozásmegoldástanácsadáscégátvétel

Adóssággal terhelt cégét átvesszük, akár másnapi aláírással. Bt vagy kft ,megoldás van. hívnia kel csak adóssággal terhelt cégekkel foglalkozunk. Bármikor hívhat 06-20/8001291
A hirdetés részletei >>

Feladva: 2013-05-17 03:26:04    [Üzlet - Vállalkozás]

Adóssággal ne küzdjön tovább, cégét átvesszük jogi úton hívjon segítek 24 órán belül adóssággal együtt cégétől meg válhat, csak olyan cég vezetők hívjanak akik már eldöntötték hogy cégüktől azonnal meg szabadulnának , hívjon 0620/8001291
A hirdetés részletei >>

Feladva: 2013-05-15 03:36:57    [Üzlet - Vállalkozás]

Nem gyorsan kell meggazdagodni, hanem nagyon! Ha már megbuktál a gyors meggazdagodást ígérő pilótajátékokkal, akkor én valódi pénzszerzési lehetőséget ajánlok neked, egy olyan üzleti vállalkozást, ahol kis befektetéssel valódi passzív jövedelemre tehetsz szert. Tudást és eszközöket kapsz a kezedbe. Élj vele és esélyed lesz egy szabadabb életre! Látogasd meg a honlapomat és töltsd ki a kérdőívet! Kérdéseidre szívesen válaszolok.
A hirdetés részletei >>

Feladva: 2013-05-13 14:09:16    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: internetes munkaotthoni online vállalkozásanyagi függetlenségpluszpénz

Elsőként profitálni egy új üzleti lehetőségből extra hasznot jelent! www.hausmann.hu
A hirdetés részletei >>

Feladva: 2013-05-13 12:52:45    [Üzlet - Vállalkozás]

Ohaus Gold Plus ékszer mérleg Belső kalibrációval és EC típus vizsgával! Folyamatos kontroll és pontosítás bármikor a beépített etalonsúlyok által!!! 16 mértékegység, pl.ct, mg, oz, lb, tael, darabszámlálás Alumínium mérlegház, függesztett mérés Háttér megvilágítású LCD kijelző, RS232, választható külső kijelző Tápellátás AC adapterről Méréshatár: 810 g
A hirdetés részletei >>

Feladva: 2013-05-11 18:48:27    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: ékszermérleg.digitális mérlegmérleghűtőszekrényborhűtőhúsdaráló

Befektetőtársat keresünk egy olyan rendszer végleges kivitelezéséhez, amely az elektromos autók hatótávolságát jelentősen megnöveli. Ha egyet ért a környezet megóvásával, de nem látja értelmét olyan gépjármű megvásárlásának, amivel nem tud kényszerített pihenés nélkül lemenni családjával a tengerpartra, akkor önre van szükségünk.A rendszer már tesztelt, és jelenleg a leghosszabb utazást biztosítja. Ha szívesen részt venne ebben a projektben, és részesülne a bevételekből, keressen a személyes ... további részletek >>

találkozó érdekében.

Feladva: 2013-05-09 15:20:49    [Üzlet - Vállalkozás]

Székhelyszolgáltatás Budapesten. Komplex adminisztratív ügyintézést, postai küldemények kezelése. Rendszeres értesítést telefonon vagy e-mailen, megállapodás szerint. Kedvező díj és költségek, folyamatos akciók székhelyszolgáltatásban Budapesten, cégügyintézés ügyvédi háttérrel. Teljes körű könyvelési szolgáltatás. (választható). Cég székhely szolgáltatásunk központi helyen Budapesten jó megközelítéssel elérhető. 06-1-267-42-54 www.szekhelyszolgalat.hu
A hirdetés részletei >>

Feladva: 2013-05-09 12:51:17    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: székhelyszolgáltatásszékhely használatszékhelybérlésszékhelybiztosításszekhely szolgaltatasszékhelyszolgáltatás szerződésszékhelyszolgálat Budapestenszékhelyszolgáltatás fel

Céges könyvelések! Vállaljuk Bt, Kft könyvelését, egyéni vállalkozók teljes körű könyvvitelét. Most folyamatos akciók és kedvezmények. Segítünk könyvelő és könyvelés váltásában. Szolgáltatásunk és áraink magukban foglalják a nyilvántartások, bevallások elkészítését, (MÉRLEGET IS), és még nagyon sok ingyenes szolgáltatást. Link: http://interport.hu Tel: 0612674254
A hirdetés részletei >>

Feladva: 2013-05-09 12:34:54    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: székhelyszolgáltatáskönyveléscégbejegyzéscégalapításcégszolgálatpénzügyi tanácsadásszékhelyszolgálatkönyvviteli szolgáltatáskönyvelőkönyvelő iroda Budapestenkft könyvelé

--- AKCIÓS HÚSÁRAK BUDAPEST ! --- Friss háztáji csirkemell ár: 1kg 890,-Ft Friss csirkemell filé ár: 1kg 1190,-Ft Friss egész csirkecomb ár: 1kg 698,-Ft Friss szegedi malachús ár: 1kg 698,-Ft Friss szegedi malac comb ár: 1kg 990,-Ft Pick eredeti téliszalámi ár: 1kg 3990,-Ft Herz eredeti téliszalámi ár: 1kg 3990,-Ft Gyulai kolbász akciós áron: 1kg 3790,- Ft --- Budapest 11.Bocskai út 42 sz.--- ---Telefon:061/3611-609 ---
A hirdetés részletei >>

Feladva: 2013-05-08 22:21:02    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: csirkemell áracsirkemell akciómalachústéliszalámi

Vállalkozói Start Csomag Ha cégvezető vagy magánvállalkozó 3 problémával biztosan szembesül ami meghatározza a mindennapjait és a sikerét is Mik ezek? Útnyilvántartás vezetése számlázás és kintlevőségek vállalkozása szervezése és feladatai kezelése Ezekre a problémákra nyújt megoldást a Vállalkozói Start Csomag, mely most kedvezményesen lehet az Öné. Levesszük a gondokat a válláról akár most kezd vállalkozásba akár új lendületet szeretne neki adni www.infocentrum.hu/start 06-30-9618888
A hirdetés részletei >>

Feladva: 2013-05-08 16:34:42    [Üzlet - Vállalkozás]

Esztergom, Ipari park területén kiadó 1500 m2 raktárcsarnok a hozzá tartozó 100 m2 iroda és szociális helyiségekkel, valamint 600 m2 burkolt, bekerített udvar területtel. Belül daruzásra is lehetőség van. Több cég szomszédságban. tel: +36306378709
A hirdetés részletei >>

Feladva: 2013-05-07 13:35:35    [Üzlet - Vállalkozás]

Webáruház induló árukészlettel Új berendezéssel 690 cipő boxal, 600 férőhelyes vállfás akasztóval, vállfákkal 200 márkás NEXT, LONSDALE, LEE COOPER gyerek cipőkkel, 350 Angol gyűjtésű Angliában válogatott fiú-lány gyerekruhákkal, futárszolgálati kapcsolattal, raktározási programmal, 5000 csomagoló zsákkal. opcióként: Pécsett üzlethelyiséggel. usedtextiluk@gmail.com Ár: 2M Ft. Igény szerint, folyamatos, ellenőrzött árukészlettel. tel:304859023
A hirdetés részletei >>

Feladva: 2013-05-07 13:23:29    [Üzlet - Vállalkozás]

Cégünk 2011. évben alakult, ezt megelőzően a vezetőség már 1998 óta működött az építőipar területén, akkor még egyéni vállalkozási formában. Kezdetben alvállalkozásban különféle élelmiszeripari beruházások acélszerkezeti munkáit végeztük, majd hagyományos építőipari beruházásokat is kiviteleztünk. Az ország számos pontján végeztünk egyedi acélszerkezeteket, könnyűszerkezetes épületeket. Az ingatlan piac hanyatlása után erőforrásainkat az acélszerkezet gyártás-szerelés, és csarnoképítés ... további részletek >>

ágazatba csoportosítottuk. Megváltozott piaci igények hatására elkezdtük kidolgozni új üzleti stratégiánkat, fejlesztési koncepciónkat. Elsődleges szempontnak tartjuk a beruházások során megtalálni a megrendelő számára legkedvezőbb műszaki megoldásokat, hozzárendelve a költségtakarékos gyors megvalósítást.

Feladva: 2013-05-07 11:20:46    [Üzlet - Vállalkozás]

Egy átlagos magyar évi 5 kg kávét fogyaszt, de nem biztos, hogy finomat. Európában másodpercenként 120000 csésze kávét fogyasztanak. Legyél Te is részese ennek az üzletnek! Ingyenes weboldalak, élvezeti cikkek - kávé, tea Egy egész világra kiterjedő vállalkozás. Komplett, jól működő logisztika. Minimális befektetéssel az egész világra kiterjedő vállalkozást hozhatsz létre. Te is meg tudod csinálni, csak akarni kell!
A hirdetés részletei >>

Feladva: 2013-05-06 16:56:26    [Üzlet - Vállalkozás]

Webáruház induló árukészlettel Új berendezéssel 690 darabos cipő boxal 600 férőhelyes vállfás akasztóval,vállfákkal 200db os márkás NEXT,LONSDALE,LEE COOPER gyermek cipőkkel 350 db Angol gyűjtésű Angliában válogatott fiú-lány gyerekruhákkal Futárszolgálati kapcsolattal raktározási programmal 5000db os csomagoló zsákkal opcióként:Pécsett üzlethelyiséggel usedtextiluk gmail.com Ár:2M Ft.- Igény szerint,folyamatos, ellenőrzött árukészlettel.
A hirdetés részletei >>

Feladva: 2013-05-06 14:53:47    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: webáruházgyerekcipőgyerekruha

--- AKCIÓS HÚSÁRAK BUDAPEST ! --- Friss háztáji csirkemell ár: 1kg 890,-Ft Friss csirkemell filé ár: 1kg 1190,-Ft Friss egész csirkecomb ár: 1kg 698,-Ft Friss szegedi malachús ár: 1kg 698,-Ft Friss szegedi malac comb ár: 1kg 990,-Ft Pick eredeti téliszalámi ár: 1kg 3990,-Ft Herz eredeti téliszalámi ár: 1kg 3990,-Ft Gyulai kolbász akciós áron: 1kg 3790,- Ft --- Budapest 11.Bocskai út 42 sz.--- ---Telefon:061/3611-609 ---
A hirdetés részletei >>

Feladva: 2013-05-04 12:38:43    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: csirkehús árakcsirkemell ármalachúspick téliszalámi

Therápiás eszközök értékesítéséhez területi képviselőt keresek extra jutalékért.
A hirdetés részletei >>

Feladva: 2013-05-03 19:51:39    [Üzlet - Vállalkozás]

Mellék jövedelem 93 ezer Ft, vagy több. Mennyi pénzre van szükséged? Csak a szorgalmadon múlik, hogy ez az összeg mennyi. Keresünk 3 fő hálózati marketingben, üzletkötésben, vagy direktértékesítésben jártas csapatépítőt. Nem alkalmazotti munka! Ha megakarsz szabadulni a napi anyagi gondoktól, jelentkezz itt! Telefonon: 06706280391 Vagy Weboldalunkon: http://jolet.sikeresen.com/urlap
A hirdetés részletei >>

Feladva: 2013-05-02 10:53:26    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: állásmunkaotthoni munkaüzleti vállalkozás

Bádogos termékek: Ereszcsatorna rendszerek és tartozékai.Műanyag ereszcsatorna 20% kedvezménnyel. Szegély és tábla lemezek. Kémény szegélyek. Forrasztó kellékek. Bádogos kézi szerszámok, tetőkibúvók, hófogók,popszegecsek, szegek.pontszellőző, kéményseprő járda. Egyedi gyártást rövid határidőre vállalunk. Tetőcsúcs díszek raktárról, illetve egyedi elképzelés szerint elkészítjük. Nyitva:H-P:7,30-17,00-ig. Páros hét szombaton:8,00-13,00-ig www.badogosbolt.hu
A hirdetés részletei >>

Feladva: 2013-04-30 07:55:32    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Bádogos termékek

kozmetikusokat, fodrászokat, szépség- és egészségházakat keresünk együttműködésre.
A hirdetés részletei >>

Feladva: 2013-04-29 19:28:16    [Üzlet - Vállalkozás]

Nagyon sürgős családi okok miatt,ingatlanom eladásából származó,több millió forintos kintlévőségemet azonnal 1,2 millió forintért eladnám. Az üzlet lebonyolítása max.60 nap. De mivel ez a pénz azonnal kell,ezért adom ennyiért. További részletekért hívd az alábbi számot: 06 30 951 8078 Minden teljesen hivatalos és minden hivatalos papírokkal azonnal igazolható. (nekem ügyvédre sincs pénzem)
A hirdetés részletei >>

Feladva: 2013-04-29 12:07:19    [Üzlet - Vállalkozás]

Megoldás számodra 146 ezerFt? Mennyi pénzre van szükséged? 100-, 200-, 500 ezer Ft-ra, vagy még többre? Keresünk 2-3 fő csapatépítőt, aki: Nyitott gondolkodású; Foglalkozott már hálózati marketinggel, vagy üzletkötéssel, direktértékesítéssel; Meg akar szabadulni a napi anyagi gondoktól; Csak a szorgalmadon múlik. Nem alkalmazotti munka! Jelentkezz most itt telefonon: 06706280391, Vagy weboldalunkon: http://jolet.sikeresen.com/urlap
A hirdetés részletei >>

Feladva: 2013-04-29 11:33:25    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: állásmunkaotthoni munkavállalkozás

Kedves Cégvezető! Tájékoztatni szeretném Önt az Intellicom legújabb, legmodernebb IT és TELECOM szolgáltatásunkról, lehetőségeinkről, műszaki megoldásainkról. Fontos információ, hogy olyan új VOIP csomagot is kínálunk megvásárlásra, amelyben telefonjának ELŐFIZETÉSI DÍJA mostantól teljes egészében lebeszélhető! Cégvezetőként, intézményvezetőként elege van abból, hogy kevesebb idő jut a profittermelő munkára, mert folyton valami probléma van a telekommunikációval, az informatikai ... további részletek >>

eszközökkel? Hívni kell a telefonost, rendszergazdát, informatikust, alközpontost (és nem jön ), addig pedig nem lehet dolgozni. Ugye ismerős? Teljes körű megoldásainkat kínáljuk az alábbi területeken: -Telekommunikáció, (vezetékes, mobil), rendszergazda, informatika, alközpont: -Hálózat építés -Beüzemelés -Üzemeltetés -Adminisztráció Nem mindegy, hogy kivel tartja a kapcsolatot. Olyan csapatra van szüksége, akik gyorsak, pontosak, precízek, megbízhatóak és mindent megoldanak. Várom jelentkezését e-mail-en vagy telefonon, hogy tudjak adni ingyenes ajánlatot a fenti szolgáltatásokra! Üdvözlettel: Soós Kálmán Mobil: +36 20 984-0472 +36 70 369-1235 WEB: www.intellicom.hu Skype: kalmis58 E-mail: soos.kalman@intellicom.hu

Feladva: 2013-04-24 15:23:12    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: olcsótelefoninternetvoip

-- SERTÉSHÚS ÁRLISTA ! -- Sertés comb ár : 1190.-Ft/kg Sertés lapocka ár : 1180.-Ft/kg Sertés karaj ár : 1190.- Ft/kg Sertés oldalas ár : 1180.-Ft/kg Sertés dagadó ár : 1180.- Ft/kg Sertés tarja ár : 1180.-Ft/kg Sertés csülök ár : 690.-Ft/kg Budapest XI.Bocskai út 42 sz. --- Telefon:061/3611-609 ---
A hirdetés részletei >>

Feladva: 2013-04-24 12:09:56    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: sertéshús árasertéshús árakhús árakhúsárakhús ár

A szépségipar teljes palettájáról, de elsődlegesen kozmetikai cikkek gyártásával és forgalmazásával foglalkozó projekteket keresünk finanszírozásra 500000 EUR-tól 10 M. EUR-ig. Ennél nagyobb összegű projektek is számításba jöhetnek egyedi elbírálás alapján. Az ipar és mezőgazdaság területéről termelés, gyártás, tenyésztés, feldolgozás valamint megújuló energiákat felhasználó projekteket is keresünk finanszírozásra. A projektekhez nem szükséges önerő, nincs kamat és a futam idő nincs korlátozva. ... további részletek >>

Csak komoly felkészült projekt gazdákkal keressük a kapcsolatokat, kész kidolgozott projektekkel.

Feladva: 2013-04-23 21:09:12    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: szépségkozmetikaprojekteurotőkefinanszírozás

Sürgősen szükségem lenne 1.000.000 Ft-ra, 2 milliót adok vissza egy éven belül, a megbeszélt ütemezés szerint. Lakásomon jelzálog van, a fedezet a több éves brókeri tevékenységem.
A hirdetés részletei >>

Feladva: 2013-04-22 19:51:16    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: befektetésmagánhitelüzlet

Azonnal, több mint 150.000 magyar emberhez juthat el az Ön cégének ajánlata és hamarosan 1.200.000 magyar ember vásárolhat az Ön cégénél! Hogyan lehetséges ez? Szeretnénk ezt Önnek bemutatni! Mindössze 3 perc, mellébeszélések nélkül. http://www.magyarkedvezmenykartya.hu/1066615c
A hirdetés részletei >>

Feladva: 2013-04-22 17:05:36    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: üzletmunkaálláskeresetmegtakarítlehetőségpénzkedvezményingyenvásárláskártyamagyarvállalkozásszolgáltatközösség

Jövedelem kiegészítésként 93 ezer Ft Keresünk 3 fő MLM-ben, üzletkötésben, vagy direktértékesítésben jártas csapatépítőt. Szükséged van mellékesen 93 ezer Ft-ra, vagy még többre?
A hirdetés részletei >>

Feladva: 2013-04-22 15:19:50    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Állásmunkaothoni munkavállalkozás

--- AKCIÓS HÚSÁRAK BUDAPEST ! --- Friss háztáji csirkemell ár : 1kg 890 Ft Friss csirkemell filé ár : 1kg 1190 Ft Friss egész csirkecomb ár : 1kg 698 Ft Friss szegedi malachús ár : 1kg 698 Ft Friss szegedi malac comb ár : 1kg 990Ft Pick eredeti téliszalámi ár : 1kg 3990 Ft Herz eredeti téliszalámi ár : 1kg 3990 Ft Gyulai kolbász akciós áron : 1kg 3790 Ft --- Budapest 11.Bocskai út 42 sz.--- *** Telefon:061/3611-609 ***
A hirdetés részletei >>

Feladva: 2013-04-22 00:31:29    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: húsárak 2013csirkemell ártéliszalámi árak

A szépségipar teljes palettájáról, de elsődlegesen kozmetikai cikkek gyártásával és forgalmazásával foglalkozó projekteket keresünk finanszírozásra 500000 EUR-tól 10 M. EUR-ig. Ennél nagyobb összegű projektek is számításba jöhetnek egyedi elbírálás alapján. Az ipar és mezőgazdaság területéről termelés, gyártás, tenyésztés, feldolgozás valamint megújuló energiákat felhasználó projekteket is keresünk finanszírozásra. A projektekhez nem szükséges önerő, nincs kamat és a futam idő nincs korlátozva. ... további részletek >>

Csak komoly felkészült projekt gazdákkal keressük a kapcsolatokat, kész kidolgozott projektekkel. Érdeklődni a projekt900@gmail.com címen lehet.

Feladva: 2013-04-21 19:23:30    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: szépségkozmetikaprojekteurotőkefinanszírozás

Pályázatát megnyerte, de nem tudja lehívni, mert nem rendelkezik önerővel, vagy az elnyert támogatásból nem tudja elképzeléseit megvalósítani tőke hiány miatt? Írjon, segítünk! Érdeklődni a finanszirozas.projektek@gmail.com címen.
A hirdetés részletei >>

Feladva: 2013-04-21 17:57:28    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: pályázattőkeeurofinanszírozásönerő

Sürgősen szükségem lenne 2.000.000 Ft-ra, 6 hónapra. Saját tulajdonú, tehermentes ingatlannal rendelkezem. 6 hónapon belül magas kamattal visszafizetem
A hirdetés részletei >>

Feladva: 2013-04-21 17:33:09    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: hitelkölcsönkamat

30.000 forintra van szükségem magánszemélytől június elejéig. 36.000 forintot tudok visszafizetni. Hirtelen kerültem nehéz helyzetbe, minden megoldás érdekel.
A hirdetés részletei >>

Feladva: 2013-04-20 08:18:49    [Üzlet - Vállalkozás]

50.000 forint kölcsönre van szükségem, egy hónapra. 15.0% kamatot tudok fizetni. Sajnos BAR-os vagyok, ezért nem fordulhatok a Providenthez.
A hirdetés részletei >>

Feladva: 2013-04-18 18:10:20    [Üzlet - Vállalkozás]

LEHETŐSÉG, PÉNZKERESETRE! Az internet iparágban is a technika gyors fejlődése magával hozza az internet kommunikáció változását s mivel az internet köti össze az egész világot annak működése nem kétséges! A kommunikáció változásához szükséges eszközöket előállító cég a termékei használatára és terjesztésére munkatársakat keres és nagyon sokat fizet a munka elvégzése után azonnal! Ha Önt érdekli a csatlakozás feltétele kérjen információt!
A hirdetés részletei >>

Feladva: 2013-04-18 10:07:27    [Üzlet - Vállalkozás]

Azonnal, több mint 150.000 magyar emberhez juthat el az Ön cégének ajánlata és hamarosan 1.200.000 magyar ember vásárolhat az Ön cégénél! Hogyan lehetséges ez? Szeretnénk ezt Önnek bemutatni! Mindössze 3 perc, mellébeszélések nélkül. http://www.magyarkedvezmenykartya.hu/1066615c
A hirdetés részletei >>

Feladva: 2013-04-18 00:21:32    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: üzletmunkaálláskeresetmegtakarítlehetőségpénzkedvezményingyenvásárláskártyamagyarvállalkozásszolgáltatközösség

Azonnali PROFIT a világ bármely pontján az INTERNET TECHNOLÓGIÁVAL! MOST csatlakozz; bárhonnan dolgozhatsz egy laptoppal és már kapod is a pénzt azonnal mehetsz a bank automatából felvenni! Egy skype nevet és telefonszámot kérek, küldöm a további infót. Ingyenes lehetőséggel nincs pénz, azt tudjuk, tehát vedd komolyan, ha passzív jövedelmet akarsz!
A hirdetés részletei >>

Feladva: 2013-04-16 20:25:53    [Üzlet - Vállalkozás]

Vásárolj alapvető élelmiszereket és háztartási cikkeket – “amit amúgy is megvennél” - egy helyen, multik árai alatt, ÉS KERESS VELE PÉNZT !!! Élsz a lehetőséggel vagy nem?! 0 kockázat! Nincsen esetleg, meg ha. Dönts okosan ! Bővebb info: http://mlmdiszkont.hu/mlmdiszkont/bemutato?ref=vu10a12e
A hirdetés részletei >>

Feladva: 2013-04-09 08:06:29    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: kereskedeleminternetes munkamlmpasszívjövedelem

Eladó egy 4 férőhelyes eurobungy trambulin, TÜV engedéllyel, automata leállással, számláló elektronikával. érd:sevigame@freemail.hu tel: 0620-3477436
A hirdetés részletei >>

Feladva: 2013-04-08 09:14:57    [Üzlet - Vállalkozás]

már 10% önerövel önnálo lakáshoz juthatsz
A hirdetés részletei >>

Feladva: 2013-04-06 15:09:18    [Üzlet - Vállalkozás]

Tiszta, nyereséges, hitelképes cégek eladók. Kp-ra vagy hitelre, de ebben az esetben előleg szűkséges.
A hirdetés részletei >>

Feladva: 2013-04-04 19:14:19    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: hitelképesnyereségescégeladás

Hogyan érhet el az Ön Cége néhány nap alatt országos ismertséget? Amint csatlakozik a Magyar Kedvezmény Kártya regisztrált felhasználói hírlevélben értesülnek az Ön cégéről. Ez több, mint150.000 hírlevelet jelent. Továbbá megismerik a Magyar Kedvezmény Kártya együttműködő partnerei is az Ön cégét. Ilyen módon kb. 1.200.000 potenciális vásárlóra tesz szert. Csatlakozzon! Azonnal 5-50 % kedvezménnyel vásárolhat. Akár 10 millió Ft kamatmentes vásárlási kerethez is juthat.
A hirdetés részletei >>

Feladva: 2013-04-03 14:45:31    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: üzletvállalkozáspiacpénznyereség

Most alapította vállalkozását és egy megbízható könyvelő céget keres? Egy vállalkozás beindításánál a megalakulás utáni napok nagyon fontosak, mert bizonyos törvény által meghatározott jogszabályi kötelezettségeknek kell eleget tenni, mint például a bejelentések, az adatlapok kitöltése, és sok egyéb hivatalos ügyintézés, ami már nem az ügyvédek feladata. Képzett szakembereink készséggel állnak rendelkezésére.
A hirdetés részletei >>

Feladva: 2013-04-03 13:41:33    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Könyvelésbérszámfejtéskönyvvizsgálattársasházak könyvelése

Gyorskölcsönt igényelnék magánszemélytől sürgősen!!! Kb. 800 000 Ft-ról lenne szó! Aki tud segíteni, minél hamarabb jelezze és a részleteket megbeszéljük!
A hirdetés részletei >>

Feladva: 2013-04-02 21:19:52    [Üzlet - Vállalkozás]

Apróhirdetés feladása ingyen és regisztráció nélkül! Weboldalunk nem csupán apróhirdető oldal. Lehetőség van arra is, hogy weboldala megjelenjen katalógusunkban, sőt, cikkeket is ingyen jelenítünk meg. Népszerűsítse vállalkozását nálunk! Web: http://www.apro.validatoria.com/
A hirdetés részletei >>

Feladva: 2013-04-02 20:16:29    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: hirdetés feladásapró

Apróhirdetés feladása ingyen és regisztráció nélkül! Weboldalunk nem csupán apróhirdető oldal. Lehetőség van arra is, hogy weboldala megjelenjen katalógusunkban, sőt, cikkeket is ingyen jelenítünk meg. Népszerűsítse vállalkozását nálunk! Web: http://www.apro.validatoria.com/
A hirdetés részletei >>

Feladva: 2013-04-02 09:58:43    [Üzlet - Vállalkozás]

Gyors és hatékony logótervezőket keres, akik elképzeléseit valóra váltják? A Link Logó.Hu fiatal logótervezői képesek weboldalát feldobni a kreatív és ötletes logóikkal. Mire vár még? 3 csomag közül választhat, amelyek az Ön igényeit támasztja alá. Ne habozzon, rendelje meg az egyiket most, és vállalkozása fellendülhet! http://www.link-logo.hu
A hirdetés részletei >>

Feladva: 2013-03-31 16:02:36    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: LinkkatalógusLink katalógusLogóLogótervezésTervezésLinkLogó tervezésLink-LogoKreatívDesign

Millionaire X 20$-ból profitálj, amennyit csak tudsz! Amennyiben beragadtak különböző rendszerekbe a pénzeid, ahogy nekünk is, és még mindig keresed a megoldást, hogy ne végérvényes veszteségként könyveld el, hanem a közeljövőben már nyereséges legyél, akkor gyere és nézd meg a bemutatót: http://bit.ly/Y7HJBh Megmutatom, hogyan alkalmazd hatékonyan TE is ezt a 3 éve működő módszert. Regisztrációért keress meg, köszönöm: Törteli László email: torteli.l@t-online.hu skype: picilacika1
A hirdetés részletei >>

Feladva: 2013-03-31 13:35:02    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: befektetésbevételbiztosfizetőautomatikusinternetesjövedelemmarketingmlmmunkamódszeronlineotthonipasszívpénzforráspénzkeresetsegítőtanítüzletvalósvállalkozás

Eladó büfé pavilon bevásárló és iroda központ területén 24 m2 felújitott állapotu berendezett polc rendszerell hütőkkel és szakhatósági engedélyekkel meleg és hideg konyhás engedély.A büfé forgalmas helyen található ahol a HIPER.HU is megtalálható,ezért aki egy kis biztos megélhetést és napi bevételt szeretne akkor megtalálta vállalkozását.Családi okok miatt sürgősen eladó személygépkocsit beszámítok további információk telefonon.
A hirdetés részletei >>

Feladva: 2013-03-30 15:02:14    [Üzlet - Vállalkozás]

Biztos hitel!Feltételek:korrektség,megbízhatóság,rugalmasság.Részleteket csak személyesen áll módomban elmondani(Budapesten),a hosszas levelezés nem vezet semmire.Akár ma is elindítható.Telefonszámot kérek.
A hirdetés részletei >>

Feladva: 2013-03-28 11:18:03    [Üzlet - Vállalkozás]

MIÉRT MINKET VÁLASSZON? -behajtás már kis összegtől -személyre szabott ügyintézés -behajtás nem csak cégeknek, hanem magánszemélyeknek is -országos lefedettség -az adós felkeresése először mindig személyesen történik -a behajtás mindig a hatályos jogszabályok maradéktalan betartásával történik -szerződésünk addig él, amíg sikerre nem vittük ügyét -a behajtást erre a célra szakosodott jogászok támogatásával végezzük
A hirdetés részletei >>

Feladva: 2013-03-26 12:06:52    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: behajtásadósságbehajtásköveteléskezelés

Magánhitelt keresek március 29-ig pénzhez kell jutnom.
A hirdetés részletei >>

Feladva: 2013-03-25 18:10:41    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: magánhitel

I am Mr. Jesse Long.A certified Loan Lender That offers loan to people who are in need of loans. We give out loans for project, business, taxes, bills, and so many others reasons.social security and no credit check, 100% Guarantee. All you have to do is let us know exactly what you want and we will surely make your dream come true. Precious Lender. says YES When your banks say NO. Lastly, we fund small scale loan firm, intermediaries, small scale for Financial Institutions have unlimited ... további részletek >>

capital.I we offer loan to loan and Those That Need willing to pay us back our offer Both personal and business loans with capital base of £ Between the amounts 5.000 to £ 50,000,000.00 GB Pounds to Individuals I loan money out to Individuals in Need of Financial assistance.Do you have a bad credit or you are in need of money to pay bills? I want to use this medium to inform you that i render Reliable beneficiary assistance as I'll be glad to offer you the loan.This gives you a real chance to get the funds you need! Are you a business man or woman? Are you in any Financial stress or do you need funds to start up your own business? Do you have a low credit score and you are finding it hard to Obtain a loan from local banks and Other Financial Institutes? With Due Respect if you know you want a loan you are kindly advice please contact us today to get your funds okay. We Offer Private, Commercial and Personal Loans with very Minimal annual Interest Rates as Low as 3% within a 1 year to 50 years repayment duration period to any part of the world. I will be waiting for any urgent RESPOND in our company if you are interested. Here is our company email address : foresightloaninvestment@gmail.com Foresight Loan Investment Company Mr.Jesse +447031958341

Feladva: 2013-03-25 10:10:54    [Üzlet - Vállalkozás]

Hogyan érhet el az Ön Cége néhány nap alatt országos ismertséget? Amint csatlakozik a Magyar Kedvezmény Kártya regisztrált felhasználói hírlevélben értesülnek az Ön cégéről. Ez több, mint150.000 hírlevelet jelent. Továbbá megismerik a Magyar Kedvezmény Kártya együttműködő partnerei is az Ön cégét. Ilyen módon kb. 1.200.000 potenciális vásárlóra tesz szert. Csatlakozzon! Azonnal 5-50 % kedvezménnyel vásárolhat. Akár 10 millió Ft kamatmentes vásárlási kerethez is juthat.
A hirdetés részletei >>

Feladva: 2013-03-25 09:48:49    [Üzlet - Vállalkozás]

Legyen az Ön Cégének is 1.200.000 potenciális üzleti partnere. Csatlakozzon a Magyar Kedvezmény Kártya programjához és a regisztrált felhasználók azonnal hírlevélben értesülnek az Ön Cégéről. A több mint 150.000 regisztrált felhasználón túl további kb. 1 millió 100 ezer felhasználó, az együttműködő partnerek hálózataiból szintén tudomást szerez az Ön Cégéről. Csatlakozzon és azonnal 5-50 % kedvezménnyel vásárolhat, melyhez akár 10 millió Ft kamatmentes vásárlási keretet is kaphat.
A hirdetés részletei >>

Feladva: 2013-03-25 08:20:06    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: üzletvállalkozáspiacpénznyereség

A hirdetés részletei >>

Feladva: 2013-03-23 13:11:48    [Üzlet - Vállalkozás]

1 000 000 millió felhasználó csatlakozott már világszerte Legyél Te is tulajdonos !!! Ingyen! A világ legnagyobb közösségi oldalai évente több milliárd dollár bevételt érnek el, az által, hogy felhasználóik teljesen ingyenesen használják oldalaikat. A GlobAllShare célja, hogy felhasználói ne csak használják, hanem a magukénak érezzék a globális közösséget és ezáltal valóban úgy formálják, ahogy nekik a legmegfelelőbb. Ezért a GlobAllShare minden felhasználójának tulajdonosi státuszt bizto
A hirdetés részletei >>

Feladva: 2013-03-22 22:09:28    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: 2000axisbroadcastcameracapturecarddigitaldvrftpinternetiplinkayslogitechmotionnetcamnetworkptzrecordsecuritysowtwaresurweillancevideowebcammaking money onl

Surgosen szuksegem lenne 330000 ezere. Sajnos bar listas vagyok es sos-ben kellenne rendeznem. Kerem aki tud segitsen vissza fizetem. Kerem ysegitsenek. Telfefon 06702241519
A hirdetés részletei >>

Feladva: 2013-03-18 21:55:17    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: pillango

Kölcsönkérnék 50.000 eurót egy évre. Garantálok falun működő farmmal, akár el is adom a farmot 100.000 euróért. Bővebb információ 0040755354240 vagy erka94@gmail.com.
A hirdetés részletei >>

Feladva: 2013-03-17 18:50:09    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: befektetéshitel

Ha Te nem szólsz az ismerőseidnek, akkor majd szól valaki más! Ebben az esetben azonban nem építed fel ezt a hálózatod, és nem kapod meg azokat a jutalékokat, amelyek Téged illetnek. Döntsd el! Élsz a lehetőséggel vagy nem?!0 kockázat! Nincsen esetleg, meg ha. Dönts okosan, és Én támogatlak! Bővebb info: http://mlmdiszkont.hu/mlmdiszkont/bemutato?ref=vu10a12e
A hirdetés részletei >>

Feladva: 2013-03-17 18:20:04    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: internetes munkapasszív jövedelemnyugdíjotthoni munkaotthon végezhető munkaállásmellékállásmellékesgyesgyedkismama munkadiákmunkanyugdíjas munkanyugdíj

Eladó Székelyudvarhelytől 20 km-re kis farm személyzettel, 3 Ha területtel, lakóházzal, csűrrel, istálló tehenekkel, mangalicáknak (kb 100 db) kialakított vadkert villanypásztorral, fürj 1000 fölött, gombapince, nyulak, tojótyúkok, gyümölcsös, 50x6m fólia, megnyert, vissza-nem-terítendő pályázat, amit lehet folytatni fejlesztés pályázattal 200.000 euróig. Ára 100.000 euró. Bővebb információ 0040755354240 és erka94@gmail.com
A hirdetés részletei >>

Feladva: 2013-03-17 17:37:05    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: farmbefektetéspályázatingatlan

Egy kiváló üzleti lehetőséggel szeretném megismertetni.  Egyszerű, azonnal megérthető marketingterv  Abszolút elérhető bárki számára, nem igényel komoly anyagi ráfordítást az elindulás  Színvonalas termék/ szolgáltatás, amire egyre több embernek van szüksége  Online termék/szolgáltatás: nem kell árukkal, pénzzel, szállítással, garanciákkal vesződni  Otthonról, szabad időbeosztással építhető  A képzés is megszerezhető az otthonod kényelméből. Bővebb tájékoztatás honlapomon: ... további részletek >>

Feladva: 2013-03-17 15:19:50    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: Domain névértékesítésweboldal készítés

Befektetőt, csendestársat keresek értéknövelő befektetéshez több mint 340 Ha területhez. A befektetés értéke pár év alatt megduplázodhat és az évi jövedelem meghaladhatja a 8%-ot. Bővebb információt erka94@gmail.com vagy a 0040755354240 telefonszámon.
A hirdetés részletei >>

Feladva: 2013-03-17 10:55:36    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: befektetőcsnedestárshozamértéknövelő

Komoly dolgok, ötletek megvalósításához tőke lehetőség 1M. EUR-TÓL - 30 M. EUR-IG. Az igénylés nem szükséges csak egy kész projekt. Nem kell hozzá önerővel rendelkezni, nincs hitelbírálati díj, és nem kell kamatot sem fizetni, nincs megkötött futamidő sem. Magasabb finanszírozási összeg egyedi elbírálás alapján lehetséges. Amennyiben ajánlatunkkal felkeltettük érdeklődését, és kész projekttel rendelkezik, várjuk jelentkezését. Érdeklődését: finanszirozas.projektek@gmail.com címen várjuk.
A hirdetés részletei >>

Feladva: 2013-03-16 21:19:33    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: tőkeprojektötletmegvalósításeurobefektetés

95 ezer Ft mellékesen Neked jól jönne? Mit szólnál hozzá? Mennyit lendítene az életeden? Csak azon múlik, hogy dolgozol-e velünk vagy nem, de azt tudd, hogy ez nem alkalmazotti munka. Ha akarod, akkor jelentkezz itt: 06706280391 vagy Weboldalunkon: http://jolet.sikeresen.com/urlap
A hirdetés részletei >>

Feladva: 2013-03-16 18:02:12    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: állásmunkaotthoni munkavállalkozásüzlet

Hogyan érhet el az Ön Cége néhány nap alatt országos ismertséget? Amint csatlakozik a Magyar Kedvezmény Kártya regisztrált felhasználói hírlevélben értesülnek az Ön cégéről. Ez több, mint150.000 hírlevelet jelent. Továbbá megismerik a Magyar Kedvezmény Kártya együttműködő partnerei is az Ön cégét. Ilyen módon kb. 1.200.000 potenciális vásárlóra tesz szert. Csatlakozzon! Azonnal 5-50 % kedvezménnyel vásárolhat. Akár 10 millió Ft kamatmentes vásárlási kerethez is juthat.
A hirdetés részletei >>

Feladva: 2013-03-15 18:02:52    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: üzletvállalkozáspiacpénznyereség

Legyen az Ön Cégének is 1.200.000 potenciális üzleti partnere. Csatlakozzon a Magyar Kedvezmény Kártya programjához és a regisztrált felhasználók azonnal hírlevélben értesülnek az Ön Cégéről. A több mint 150.000 regisztrált felhasználón túl további kb. 1 millió 100 ezer felhasználó, az együttműködő partnerek hálózataiból szintén tudomást szerez az Ön Cégéről. Csatlakozzon és azonnal 5-50 % kedvezménnyel vásárolhat, melyhez akár 10 millió Ft kamatmentes vásárlási keretet is kaphat.
A hirdetés részletei >>

Feladva: 2013-03-15 17:29:24    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: üzletvállalkozáspiacpénznyereség

Én vagyok Mr. Christopher Long.A hiteles hitel hitelező kínáló hitelt az emberek, akik a szükséges hitelek. Adunk hitelt a projekt, üzleti, adók, számlák, és sokan mások reasons.social biztonság és nincs hitel ellenőrzés, 100% garancia. Mindössze annyit kell tennie, hogy tudassa velünk, hogy pontosan mit akar, és mi biztosan, hogy az álmod valóra válik. Sprint bizalom Finance Security. azt mondja, IGEN, ha a bankok azt mondják NO. Végül, alap kisméretű hitel cég, közvetítő, kisebb pénzintézetek ... további részletek >>

már korlátlan capital.I ajánlatot kölcsön azon, hogy szükség van kölcsön és hajlandó megfizetni minket ajánlatunkat mind a személyes és üzleti hitelek tőkéjének összege közti Ft 5.000 £ 50,000,000.00 GB font Magánszemély i kölcsön pénzt ki rászoruló személyek pénzügyi assistance.Do van egy rossz hitel, vagy ha szükségük van pénz fizetni számláit? szeretném használni ezt a médiumot tájékoztatni arról, hogy én teszi megbízható kedvezményezett segítséget fogok örülni, hogy Önnek egy loan.This ad egy esélyt, hogy a pénzeszközök amire szüksége van! Ön üzletember vagy nő? Ön bármely pénzügyi stressz, vagy van szüksége alapok beindításához saját üzletét? Van egy kis hitel pontszám, és számos nehézséggel kell megküzdenie szerezni egy kölcsön a helyi bankok és más pénzügyi intézmények? With tiszteletem, ha tudod, hogy szeretne egy kölcsönt, kérjük akkor szíveskedjen tanácsot, hogy lépjen kapcsolatba velünk még ma, és kap a pénzeszközök rendben. ajánlunk magán-, kereskedelmi-és személyi hitelek nagyon minimális éves kamatok Olcsó 3% belül 1 év és 50 év törlesztés időtartama időszak bármely részén a világnak. Fogok várni bármilyen sürgős választ a cég, ha érdekel. Itt van a cég e-mail címe sprinttrustfinance@hotmail.com Sprint bizalom Finance Security Mr.Christopher Long +447024064911

Feladva: 2013-03-15 13:13:02    [Üzlet - Vállalkozás]

Üzlettársat keresek büfé, pizzéria nyitásához Budapesten. Motiváció, tőke szükségeltetik.
A hirdetés részletei >>

Feladva: 2013-03-14 15:17:35    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: üzlettárs büfé vállalkozás

A SIC Hungary Kft legfőbb profilja az egyedi gumiipari termékek készítése a tervezéstől a tömeggyártásig. Palettánkon megtalálható a műszaki területeken fellelhető gumi, vagy gumi tartalmú alkatrész, gumi-fém kötés. Egyaránt gyártunk vízcsöveket, tömítéseket, egyedi, különböző keménységű és minőségű, szélsőséges behatásoknak is ellenálló alkatrészeket.
A hirdetés részletei >>

Feladva: 2013-03-13 15:55:46    [Üzlet - Vállalkozás]

A pénzügyi siker nagy szakértelmet igényel. Szakértelmet kétféleképp szerezhetsz: megtanulod,vagy megfizeted. Bármelyiket választod, rengeted időt és pénzt kell áldozni rá. Kivéve,ha \\\\\\\\\\\\\\\\”profik\\\\\\\\\\\\\\\\” pénzével együtt fektetsz be. A BNK Network magyar vezetéssel,ügyfélszolgálattal végzi a munkáját. Jogi,gazdasági helyzete rendezett,mindenben megfelel a törvényi követelményeknek. A befektetés alapján havi 5% (évi 60%) értéknövekedésre és havi 2,5% ... további részletek >>

osztalékelőlegre számíthatsz.

Feladva: 2013-03-12 00:37:53    [Üzlet - Vállalkozás]

Ha már egyszer kötelező az elsősegély doboz, érdemes mihamarabb beszerezni! A munkahelyi elsősegély dobozok pótlásáról a munkáltatónak kell gondoskodnia, tegye meg kényelmesen, akár a székben ülve! Webáruházunkban többféle kiszerelésű céges elsősegélydoboz közül válogathat, az alkalmazotti létszám függvényében. Céges mentődobozok 7795 Ft-tól!
A hirdetés részletei >>

Feladva: 2013-03-11 16:23:48    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: metődobozmentőládaelsősegély felszereléselsősegély dobozokcéges mentődobozmunkahelyi mentődobozokmunkahelyi elsősegély dobozokwebáruházszolgáltatásvállalkozás

Spanyolországban induló vállalkozáshoz hosszútávra tőketársat keresek. Biztos megélhetést alapozhat meg nem nagy befektetéssel. A szükséges tőke 20000 euro. Az üzlet megnyitásához részünkről is legkevesebb 20000 euro a befektetett összeg, így a részesedés 50-50 %. További információkért kérem keressen bennünket email-ben: spanish1@email.com
A hirdetés részletei >>

Feladva: 2013-03-09 14:20:22    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: tőketársbefektetésrészesedés

HotReg! A legjobb üzletek forrón ajánlva. Ingyenesen regisztráció! http://hotreg.hu
A hirdetés részletei >>

Feladva: 2013-03-09 08:09:29    [Üzlet - Vállalkozás]

Pénz, siker, csillogás? Itt cégünk a megoldás! Hirdeti mindenki, nálunk viszont,az a lényeg, hogy többen éljenek anyagi jóllétben, ne csak kevesen gazdagságban. És mindenki jól is jár. Az is jól jár aki ingyenesen regisztrál! http://hotreg.hu
A hirdetés részletei >>

Feladva: 2013-03-09 07:56:48    [Üzlet - Vállalkozás]

1,5 Millió Ft-ot szeretnék felvenni magánszemélytől, max. 30 ezer Ft/hó törlesztéssel.
A hirdetés részletei >>

Feladva: 2013-03-08 17:37:30    [Üzlet - Vállalkozás]

Olyan munkatársakat keresek, akik hajlandóak áldozatot hozni magukért, hogy boldoguljanak ebben a felgyorsult, bonyolított modern világban, ahol internet kínálta lehetőséget kihasználva, otthonról vagy bárhonnan nem kevés PÉNZT akarnak keresni! Az ingyenes skype az egymás közötti kapcsolattartási eszköz, kérem a skype nevét küldje el. Tel: 36309130712http://app.s2.talkfusion.com/fusion2/view.asp?MzIyMDA0MA==_12190161
A hirdetés részletei >>

Feladva: 2013-03-07 10:09:32    [Üzlet - Vállalkozás]

90 ezer Ft mellékesen Neked jól jönne? Mit szólnál hozzá? Mennyit lendítene az életeden? Csak azon múlik, hogy dolgozol-e velünk vagy nem. Ha akarod, akkor jelentkezz itt: 06706280391 vagy Weboldalunkon: http://jolet.sikeresen.com/urlap
A hirdetés részletei >>

Feladva: 2013-03-06 15:14:31    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: állásmunkaotthoni munkavállalkozásüzlet

Ha mérleget, digitális mérlegek keres, ne hagyja ki a Mérlegvásár webáruház meglátogatását. Kínálatunkban szerepel. mérlegek, raktár mérleg, labor mérleg, ipari mérleg, hídmérleg, bolti mérlegek, bolti árszorzós mérlegek. http://www.merlegvasar.hu/ http://merlegvasar.blogspot.com/
A hirdetés részletei >>

Feladva: 2013-03-05 22:48:03    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: digitális mérlegmérlegmérlegekhűtőpultcsemegepultbolti mérleghídmérleglabormérlegszeletelőhúsdarálómérlegjavításmérlegvásár.hu

Pénz, siker, csillogás? Itt cégünk a megoldás! Hirdeti mindenki, nálunk viszont,az a lényeg, hogy többen éljenek anyagi jóllétben, ne csak kevesen gazdagságban. És mindenki jól is jár. Az is jól jár aki ingyenesen regisztrál! http://hotreg.hu
A hirdetés részletei >>

Feladva: 2013-03-05 19:16:13    [Üzlet - Vállalkozás]

Végre itt a lehetőség, hogy a lehető legkedvezőbb áron vásárolhasd meg azokat a termékeket, amiket eddig is megvettél. Spórolj háztartási költségeiden, sőt keress vele pénzt.Mától vásárolj saját zsebre! Felejtsd el a többezres pénztári blokkokat. Legyen a te bevásárlóközpontod is az mlm diszkont. Nézd meg a videot gondolkozz el az ésszerű lehetőségen, és dönts jól, a regisztráció ingyenes! http://mlmdiszkont.hu/mlmdiszkont/bemutato?ref=rjh08662
A hirdetés részletei >>

Feladva: 2013-03-04 18:35:11    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: diszkontvásárlásolcsójutalékkeresetbevételaruhazmlm

Átadom Önnek luxusutazás nyereményemet. Döntse el, hogy kivel szeretné ezt a luxusutazást élvezni. A világon egyedülálló tájak. Megismerheti a mesés Törökországot és lakóit. Megismerheti az UNESCO által a világ kulturális örökségének nyilvánított Pamukkale fehér mészkőteraszait, a csodálatos tengerparti Kemer szélesen húzódó strandjait, valamint a Földközi-tenger gyöngyszemének nevezett Antalyát. Ingyen repülőút, szállás (8nap/7éjszaka) stb…
A hirdetés részletei >>

Feladva: 2013-03-04 12:33:52    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: luxusutazáspihenéskultúraélmény

Internet kommunikációs eszközöket gyártó és globális szolgáltatást nyújtó cég munkatársakat keres! Az elvégzett munkát azonnal kifizeti. Gyors és korrekt információ kb. 15 perc kizárólag skypen (mandal-8) naponta 8-9 és 17-21 óra között s még sem nyeri el tetszését, skype nevét azonnal törülheti. Tel: 36309130712
A hirdetés részletei >>

Feladva: 2013-03-04 08:03:59    [Üzlet - Vállalkozás]

van egy 30 millios házam nincs rajta hitel és most nem is akarok banki kölcsönt mert árulom. 17 millióra lenne szükségem amit egyből visszaadnék a ház árából addig meg tudnám törleszteni is havi 200 ezerrel.Csak komoly ajánlatok érdekelnek.
A hirdetés részletei >>

Feladva: 2013-03-03 20:58:51    [Üzlet - Vállalkozás]

Címkék, kulcsszavak: magánhitelt keresek

Kategóriák: •   Egyéb   •   Állás - Munka   •   Állás - Munka - Távmunka   •   Állat - Növény   •   Autó, motor, jármű   •   Baba, mama   •   Bútor, lakberendezés   •   Család, szabadidő   •   Dísztárgy, ajándék   •   Egészség   •   Elektronika   •   Gép, szerszám   •   Háztartás, kert   •   Hobbi   •   Ingatlan - eladó   •   Ingatlan - kiadó   •   Ingyen elvihető, csere   •   Internet   •   Könyv - Fotó - Film   •   Mobil   •   Oktatás   •   Óra, ékszer   •   Régiség   •   Ruházat, cipő   •   Sport, sporteszköz   •   Számítástechnika   •   Szolgáltatás   •   Szórakozás, programok   •   Társkereső   •   Társkereső (komoly kapcsolat)   •   Utazás, üdülés   •   Üzlet - Vállalkozás   •   Zene, hangszer  

tegnap, 2 napja, 3 napja, 4 napja, 5 napja, 6 napja

•   vízesések,   •   sofőr   •   darázs   •   társasági adó   •   ingyen   •   logisztika szak   •   távmunka   •   használtruha,bálás ruha,olcsó bálás ruhamárkás ruha,ruha csomag,olcsó ruha   •   MLM   •   energetika   •   lakberendezés   •   euró   •   konyhai kisegítő,németmunka, német,munka,állás,mu nkahely,szobalány   •   németállás,felszolgá ló,vendéglátás   •   taxi,budaörs,transzf er,reptér,törkbálint   •   logisztikai továbbképzés   •   adó   •   Aljzatbeton   •   Sürgős hitel ajánlat.   •   fényezés  